SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.03g046100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.03g046100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.03g046100

Feature Type:gene_model
Chromosome:Gm03
Start:5868801
stop:5869801
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G70730.1AT Phosphoglucomutase/phosphomannomutase family protein JGI N/AIEA
GO:0005975GO-bp carbohydrate metabolic process EnsemblGenomesN/AIEA
GO:0005975GO-bp carbohydrate metabolic process JGI N/AIEA
GO:0005978GO-bp glycogen biosynthetic process EnsemblGenomesN/AIEA
GO:0006006GO-bp glucose metabolic process EnsemblGenomesN/AIEA
GO:0009590GO-bp detection of gravity EnsemblGenomesN/AIEA
GO:0019252GO-bp starch biosynthetic process EnsemblGenomesN/AIEA
GO:0019388GO-bp galactose catabolic process EnsemblGenomesN/AIEA
GO:0071704GO-bp organic substance metabolic process EnsemblGenomesN/AIEA
GO:0005829GO-cc cytosol EnsemblGenomesN/AIEA
GO:0009570GO-cc chloroplast stroma EnsemblGenomesN/AIEA
GO:0010319GO-cc stromule EnsemblGenomesN/AIEA
GO:0004614GO-mf phosphoglucomutase activity EnsemblGenomesN/AIEA
GO:0016868GO-mf intramolecular transferase activity, phosphotransferases EnsemblGenomesN/AIEA
GO:0016868GO-mf intramolecular transferase activity, phosphotransferases JGI N/AIEA
PTHR22573Panther PHOSPHOHEXOMUTASE FAMILY MEMBER JGI N/AIEA
PTHR22573:SF5Panther JGI N/AIEA
PF02880PFAM Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III JGI N/AIEA
GLUCOSE1PMETAB-PWYSoyCyc9 glucose and glucose-1-phosphate degradation Plant Metabolic Network ISS
PWY-3801SoyCyc9 sucrose degradation II (sucrose synthase) Plant Metabolic Network ISS
PWY-5661SoyCyc9 GDP-glucose biosynthesis Plant Metabolic Network ISS
PWY-622SoyCyc9 starch biosynthesis Plant Metabolic Network ISS
PWY-6317SoyCyc9 D-galactose degradation I (Leloir pathway) Plant Metabolic Network ISS
PWY-7238SoyCyc9 sucrose biosynthesis II Plant Metabolic Network ISS
PWY-7343SoyCyc9 UDP-α-D-glucose biosynthesis I Plant Metabolic Network ISS
PWY-7345SoyCyc9 superpathway of anaerobic sucrose degradation Plant Metabolic Network ISS
PWYQT-4466SoyCyc9 superpathway of sucrose and starch metabolism I (non-photosynthetic tissue) Plant Metabolic Network ISS
SUCSYN-PWYSoyCyc9 sucrose biosynthesis I (from photosynthesis) Plant Metabolic Network ISS
GN7V-59945SoyCyc9-rxn phosphoglucomutase (glucose-cofactor) Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.03g046100 not represented in the dataset

Glyma.03g046100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma03g05590 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.03g046100.1 sequence-type=CDS polypeptide=Glyma.03g046100.1.p locus=Glyma.03g046100 ID=Glyma.03g046100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGATGATTGTCTCATCCCCCAAAGCCAAAAGGTTAAAACTCAATAACTGCACTTTTATATTATTAAATCACGTGAGCATGCCAACCTCTGCTGTCCTGGATGTTGTTGCCAAACATCTGAATTTGAAATTTTTTGAGATATATTGCTCTTCAATACATAAATTCTTTGGTAATTTAATGGATACTGGATTATGTTCAGTCTGTGGTGAAGAAAGTTTTGGGACTGGTTCAGACCGTATTCGTGAGAAAGATGGAATCTGGGAAGTTTTGGCCTGGCTATCTATACTTGCATATAAAAATAAAGATAAACTTGAAGACAAGCTTGTCACTGTTGAAGACATAAAGGTGGATGCAGGTGCAGCGAAGGAACTGATGGCATATTTGGTCAAGCTGCAGTCCTCACTTTCAGAAGTCAATCAGTATGTTAATTTTAGTACACTAACAATAGAAGCTATTTGGTTCACTCAATTAAGAAAAGAATCTTAA

>Glyma.03g046100.1.p sequence-type=predicted peptide transcript=Glyma.03g046100.1 locus=Glyma.03g046100 ID=Glyma.03g046100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MMIVSSPKAKRLKLNNCTFILLNHVSMPTSAVLDVVAKHLNLKFFEIYCSSIHKFFGNLMDTGLCSVCGEESFGTGSDRIREKDGIWEVLAWLSILAYKNKDKLEDKLVTVEDIKVDAGAAKELMAYLVKLQSSLSEVNQYVNFSTLTIEAIWFTQLRKES*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo