|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G50740.1 | AT | UDP-glucosyl transferase 72E1 | JGI | N/A | IEA |
GO:0008152 | GO-bp | metabolic process | EnsemblGenomes | N/A | IEA |
GO:0008152 | GO-bp | metabolic process | JGI | N/A | IEA |
GO:0016740 | GO-mf | transferase activity | EnsemblGenomes | N/A | IEA |
GO:0016757 | GO-mf | transferase activity, transferring glycosyl groups | EnsemblGenomes | N/A | IEA |
GO:0016758 | GO-mf | transferase activity, transferring hexosyl groups | EnsemblGenomes | N/A | IEA |
GO:0016758 | GO-mf | transferase activity, transferring hexosyl groups | JGI | N/A | IEA |
PTHR11926 | Panther | GLUCOSYL/GLUCURONOSYL TRANSFERASES | JGI | N/A | IEA |
PTHR11926:SF15 | Panther | JGI | N/A | IEA | |
PF00201 | PFAM | UDP-glucoronosyl and UDP-glucosyl transferase | JGI | N/A | IEA |
PWY-5125 | SoyCyc9 | anthocyanin biosynthesis | Plant Metabolic Network | ISS | |
PWY-7267 | SoyCyc9 | anthocyanin biosynthesis (pelargonidin 3-O-glucoside) | Plant Metabolic Network | ISS | |
PWY-7450 | SoyCyc9 | anthocyanidin modification (Arabidopsis) | Plant Metabolic Network | ISS | |
GN7V-49829 | SoyCyc9-rxn | anthocyanidin 3-O-glucosyltransferase | Plant Metabolic Network | ISS |
Glyma.03g032600 not represented in the dataset |
Glyma.03g032600 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma03g03841 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.03g032600.1 sequence-type=CDS polypeptide=Glyma.03g032600.1.p locus=Glyma.03g032600 ID=Glyma.03g032600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCTTTGGGGTTGGAGCTGAGTGGAAATAAATTTGTTTGGTCTGTGCGCCCACCTGTCACCAAAGCTGGCACTGGCAACTATCTCACAGCAGGTGCACCTCTTGGAGAAACCGGAACTACCCTTGGGTCTAATAATGAACCATCAAATTCTTTTCCTGATGAGTTCTACCGCATACAAACCAATGGAATTGTGATCACAGATTGGGCACCACAATTGGATATTTTGAAGCACCCATCTATTGGTGGTTTTGTGTCTCATTGTGGGTGGAACTCATTAATAGAGAGTGTTTCATGTGGGGTGCCAATAATTGGATTGCCTCTTTTTGCAGAGCAAATGATGAATGCTACGATGCTAATGGAGGAAGTTGGCAATGCAATTCGAGTATAG
>Glyma.03g032600.1.p sequence-type=predicted peptide transcript=Glyma.03g032600.1 locus=Glyma.03g032600 ID=Glyma.03g032600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MALGLELSGNKFVWSVRPPVTKAGTGNYLTAGAPLGETGTTLGSNNEPSNSFPDEFYRIQTNGIVITDWAPQLDILKHPSIGGFVSHCGWNSLIESVSCGVPIIGLPLFAEQMMNATMLMEEVGNAIRV*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||