Report for Sequence Feature Glyma.03g009300
| Feature Type: | gene_model |
| Chromosome: | Gm03 |
| Start: | 916024 |
| stop: | 917513 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.03g009300
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT1G13870.1 | AT |
DRL1 |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.03g009300 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma03g01166 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.03g009300
>Glyma.03g009300.1 sequence-type=CDS polypeptide=Glyma.03g009300.1.p locus=Glyma.03g009300 id=Glyma.03g009300.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGCAGTGGGAAGTCCAAAGCTGCACGCTGTCTTGCCGAAGCTCTCAAAGAATCAGAACCAAAACATCAAGTGAAAATCATAGGATGCGAGGAACCTTCCTAAAATTGACAGGGCAAACAAGTTTAAGTGGTCCACCACCTCCTTCTGATGCAGATAGTGCAAAAAGAATGTTCATTGACTACTTGAACAGGGAACTGGGAACATCCTGA
Predicted protein sequences of Glyma.03g009300
>Glyma.03g009300.1.p sequence-type=predicted peptide transcript=Glyma.03g009300.1 locus=Glyma.03g009300 id=Glyma.03g009300.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MQWEVQSCTLSCRSSQRIRTKTSSENHRMRGTFLKLTGQTSLSGPPPPSDADSAKRMFIDYLNRELGTS*