|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G61620.1 | AT | 3'-5'-exoribonuclease family protein | JGI | N/A | IEA |
| GO:0016075 | GO-bp | rRNA catabolic process | EnsemblGenomes | N/A | IEA |
| GO:0031125 | GO-bp | rRNA 3'-end processing | EnsemblGenomes | N/A | IEA |
| GO:0034427 | GO-bp | nuclear-transcribed mRNA catabolic process, exonucleolytic, 3'-5' | EnsemblGenomes | N/A | IEA |
| GO:0034475 | GO-bp | U4 snRNA 3'-end processing | EnsemblGenomes | N/A | IEA |
| GO:0071028 | GO-bp | nuclear mRNA surveillance | EnsemblGenomes | N/A | IEA |
| GO:0071051 | GO-bp | polyadenylation-dependent snoRNA 3'-end processing | EnsemblGenomes | N/A | IEA |
| GO:0000176 | GO-cc | nuclear exosome (RNase complex) | EnsemblGenomes | N/A | IEA |
| GO:0000177 | GO-cc | cytoplasmic exosome (RNase complex) | EnsemblGenomes | N/A | IEA |
| GO:0005730 | GO-cc | nucleolus | EnsemblGenomes | N/A | IEA |
| PTHR11953 | Panther | RIBONUCLEASE PH RELATED | JGI | N/A | IEA |
| PF01138 | PFAM | 3' exoribonuclease family, domain 1 | JGI | N/A | IEA |
|
Glyma.03G255200 not represented in the dataset |
Glyma.03G255200 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.19g252800 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g255200 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma03g41610 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.03g255200.1 sequence-type=CDS polypeptide=Glyma.03g255200.1.p locus=Glyma.03g255200 ID=Glyma.03g255200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGAATACGTCAGCCCAGAAGGACTTCGCTTGGATGAGATTGGTGCTGTATCCAAAGCAGATGGTTCTTCCATTTTTGAGATGGGTAATACCGAAGTTACTGCTGCTGTTTATGGCCCTAGAGAGGTGCAAAATAGGAGCCAACAAATAAGTAGCCATGCCCTGGTTCGGTGTGAGTACAGCCTGGCTAATTTTAGCACTGGAGATCGCATGAGGAAATCTAAGGGTGACAGGTTGTACTTATTTACTTGTTTAACTTCCTAA
>Glyma.03g255200.1.p sequence-type=predicted peptide transcript=Glyma.03g255200.1 locus=Glyma.03g255200 ID=Glyma.03g255200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MEYVSPEGLRLDEIGAVSKADGSSIFEMGNTEVTAAVYGPREVQNRSQQISSHALVRCEYSLANFSTGDRMRKSKGDRLYLFTCLTS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||