SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.03G251400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.03G251400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.03G251400

Feature Type:gene_model
Chromosome:Gm03
Start:44718734
stop:44719931
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G04530.1AT phosphoenolpyruvate carboxylase kinase 2 JGI N/AIEA
GO:0006468GO-bp protein phosphorylation EnsemblGenomesN/AIEA
GO:0006468GO-bp protein phosphorylation JGI N/AIEA
GO:0016310GO-bp phosphorylation EnsemblGenomesN/AIEA
GO:0018105GO-bp peptidyl-serine phosphorylation EnsemblGenomesN/AIEA
GO:0035556GO-bp intracellular signal transduction EnsemblGenomesN/AIEA
GO:0046777GO-bp protein autophosphorylation EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0005737GO-cc cytoplasm EnsemblGenomesN/AIEA
GO:0000166GO-mf nucleotide binding EnsemblGenomesN/AIEA
GO:0004672GO-mf protein kinase activity EnsemblGenomesN/AIEA
GO:0004672GO-mf protein kinase activity JGI N/AIEA
GO:0004674GO-mf protein serine/threonine kinase activity EnsemblGenomesN/AIEA
GO:0004683GO-mf calmodulin-dependent protein kinase activity EnsemblGenomesN/AIEA
GO:0005516GO-mf calmodulin binding EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding JGI N/AIEA
GO:0009931GO-mf calcium-dependent protein serine/threonine kinase activity EnsemblGenomesN/AIEA
GO:0016301GO-mf kinase activity EnsemblGenomesN/AIEA
KOG0033 KOG Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily JGI N/AIEA
PTHR24349Panther SERINE/THREONINE-PROTEIN KINASE JGI N/AIEA
PF00069PFAM Protein kinase domain JGI N/AIEA
GLUCONEO-PWYSoyCyc9 gluconeogenesis I Plant Metabolic Network ISS
PWY-561SoyCyc9 superpathway of glyoxylate cycle and fatty acid degradation Plant Metabolic Network ISS
GN7V-55577SoyCyc9-rxn phosphoenolpyruvate carboxykinase (ATP) Plant Metabolic Network ISS

LocusGene SymbolProtein Name
PPCK1 phosphoenolpyruvate carboxylase kinase
PPCK1 Phosphoenolpyruvate carboxylase protein kinase 1

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.03G251400 not represented in the dataset

Glyma.03G251400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma.03g251400 Wm82.a4.v1ISS As supplied by JGI
Glyma03g41190 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.03g251400.1 sequence-type=CDS polypeptide=Glyma.03g251400.1.p locus=Glyma.03g251400 ID=Glyma.03g251400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTATAGAGAAGCAGCGGTGAAGAAAGAGGAATACCAAGTGTTGGAAGAACTCGGGCGAGGCCGTTTCGGCACCGTGTTCCGCTGCTTCCACCGCACTTCAAACAAATTCTACGCGGCTAAACTCATCGAGAAGCGCAGACTCCTAAACGAGGACAGGCGCTGCATCGAAATGGAGGCCAAGGCCATGAGCTTCCTCTCTCCACACCCAAACATCCTCCAAATCATGGACGCCTTCGAGGACGCCGACTCCTGCTCCATAGTCCTGGAGCTCTGCCAGCCACACACCCTCTTGGACCGCATCGCCGCCCAAGGCCCCTTGACGGAGCCCCACGCCGCCAGCCTCCTCAAACAGCTTCTGGAGGCCGTGGCGCACTGCCACGCCCAGGGACTCGCGCACAGGGACATCAAGCCGGAAAACATCCTGTTCGATGAAGGGAACAAGCTTAAGCTCTCAGACTTCGGGTCCGCCGAGTGGTTGGGTGAGGGGAGTAGCATGAGCGGTGTGGTGGGGACGCCCTATTACGTTGCACCCGAAGTGATTATGGGGAGAGAGTACGATGAGAAGGTTGATGTGTGGAGCAGCGGGGTCATTCTTTACGCCATGTTGGCTGGCTTTCCACCCTTTTATGGAGAGTCTGCTCCCGAAATCTTTGAGTCTGTTTTGAGGGCTAATCTTAGGTTTCCCAGCCTAATCTTTAGCTCTGTTTCTGCACCTGCTAAGGACCTCCTTAGGAAAATGATTTCCAGGGATCCCTCTAACCGCATTTCCGCACATCAAGCCTTGCGACACCCGTGGATTTTGACTGGGGCTCTCACCACTGCAACTATATCCAATTTTCTCACTTAA

>Glyma.03g251400.1.p sequence-type=predicted peptide transcript=Glyma.03g251400.1 locus=Glyma.03g251400 ID=Glyma.03g251400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MYREAAVKKEEYQVLEELGRGRFGTVFRCFHRTSNKFYAAKLIEKRRLLNEDRRCIEMEAKAMSFLSPHPNILQIMDAFEDADSCSIVLELCQPHTLLDRIAAQGPLTEPHAASLLKQLLEAVAHCHAQGLAHRDIKPENILFDEGNKLKLSDFGSAEWLGEGSSMSGVVGTPYYVAPEVIMGREYDEKVDVWSSGVILYAMLAGFPPFYGESAPEIFESVLRANLRFPSLIFSSVSAPAKDLLRKMISRDPSNRISAHQALRHPWILTGALTTATISNFLT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo