|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G23930.1 | AT | probable small nuclear ribonucleoprotein G | JGI | N/A | IEA |
| GO:0000387 | GO-bp | spliceosomal snRNP assembly | EnsemblGenomes | N/A | IEA |
| GO:0000398 | GO-bp | mRNA splicing, via spliceosome | EnsemblGenomes | N/A | IEA |
| GO:0005681 | GO-cc | spliceosomal complex | EnsemblGenomes | N/A | IEA |
| GO:0005682 | GO-cc | U5 snRNP | EnsemblGenomes | N/A | IEA |
| GO:0005685 | GO-cc | U1 snRNP | EnsemblGenomes | N/A | IEA |
| GO:0005686 | GO-cc | U2 snRNP | EnsemblGenomes | N/A | IEA |
| GO:0005687 | GO-cc | U4 snRNP | EnsemblGenomes | N/A | IEA |
| GO:0005689 | GO-cc | U12-type spliceosomal complex | EnsemblGenomes | N/A | IEA |
| GO:0034719 | GO-cc | SMN-Sm protein complex | EnsemblGenomes | N/A | IEA |
| GO:0043186 | GO-cc | P granule | EnsemblGenomes | N/A | IEA |
| GO:0071004 | GO-cc | U2-type prespliceosome | EnsemblGenomes | N/A | IEA |
| GO:0071011 | GO-cc | precatalytic spliceosome | EnsemblGenomes | N/A | IEA |
| GO:0071013 | GO-cc | catalytic step 2 spliceosome | EnsemblGenomes | N/A | IEA |
| GO:0097526 | GO-cc | spliceosomal tri-snRNP complex | EnsemblGenomes | N/A | IEA |
| GO:0003723 | GO-mf | RNA binding | EnsemblGenomes | N/A | IEA |
| KOG1780 | KOG | Small Nuclear ribonucleoprotein G | JGI | N/A | IEA |
| PTHR10553 | Panther | SMALL NUCLEAR RIBONUCLEOPROTEIN | JGI | N/A | IEA |
| PF01423 | PFAM | LSM domain | JGI | N/A | IEA |
|
Glyma.03G197100 not represented in the dataset |
Glyma.03G197100 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.19g195100 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.03g197100 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma03g35490 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.03g197100.1 sequence-type=CDS polypeptide=Glyma.03g197100.1.p locus=Glyma.03g197100 ID=Glyma.03g197100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGAGCAGATCAGGGCAACCACCGGATTTGAAGAAGTACATGGACAAGAAGCTTCAGATCAAGCTGAATGCAAATCGCATGGTTGTTGGTACTCTCCGTGGCTTCGACCAGTTTATGAATTTAGTTGTTGACAACACTGTGGAAGTGAATGGCAATGAGAAAAATGACATAGGGATGGTGGTAATCAGAGGAAATAGTGTGGTCACTGTTGAGGCGCTTGAACCTGTGAACAGGACTTGA
>Glyma.03g197100.1.p sequence-type=predicted peptide transcript=Glyma.03g197100.1 locus=Glyma.03g197100 ID=Glyma.03g197100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MSRSGQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVVDNTVEVNGNEKNDIGMVVIRGNSVVTVEALEPVNRT*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||