Glyma.03G195800

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.03G195800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.03G195800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.03G195800

Feature Type:	gene_model
Chromosome:	Gm03
Start:	40576740
stop:	40582929
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.03G195800

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G03905.1	AT	Iron-sulphur cluster biosynthesis family protein	JGI	N/A	IEA
KOG1120	KOG	Fe-S cluster biosynthesis protein ISA1 (contains a HesB-like domain)	JGI	N/A	IEA
PTHR10072	Panther	IRON-SULFUR CLUSTER ASSEMBLY PROTEIN	JGI	N/A	IEA
PF01521	PFAM	Iron-sulphur cluster biosynthesis	JGI	N/A	IEA

Expression Patterns of Glyma.03G195800

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.03G195800 not represented in the dataset	Glyma.03G195800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.03G195800 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.03g195800	Wm82.a4.v1	ISS	As supplied by JGI

Transcripts of Glyma.03G195800

Limit To All Plant Sequences

>Glyma.03g195800.2 sequence-type=transcript locus=Glyma.03g195800 ID=Glyma.03g195800.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
AGAGATACAGAGGTCGCTAATTCGACGCCTGGCGCCGCCATTGGCGACGGCGCGGCGCGATTGAGGcttcttcattctcttcttcttctgttgttcaccattgccacttcttcttctgattctGATCCTGACTTGGAGCCCCTTCACATGACTAAAAACTGCGTTCGAGAACTAGAAGCCAGTGAATCATCAGCAGACAGAAAAATGCTTCCTTTAAGCGTAGAAACTGGTGGATGTGCTGGATTTCAggtttttgagagggatggaattaagttggttgttgacaatatttcatatgattttgtgaaaggcgcgactgttgactatgttgaggaactatcttcgcattctttcctccacagAGTGACATGTTGCATCTTGTTATGTGGATGTTTCAGTGGCACTCCTGACTGAGCTTCTGCTAGGGACGGCACTCTCCCAAACACCGGTCAGGTTTTAGGGCACACCTCTTCTGACTGCGCAAACAAAGTGCCGCCAGTAGAGGATGAGCCTAGAAAATGAGTAACTGTAGTACTACACCTTAAACCAAGGCTACATGTTGGTTTCGTAATTTGTTAACACTTAATAACTTGAAGTTTGATGTATCTCTTAAAATGTAACCCATAGAAATTTCCAATTAAGGAGCGTCACCCAGGAACTTTCTTTTCGTTATTGAGCATACTGATTCCTTTGTAATCACAACCAGCCGTGATCCATGTGTTGTCTTACATAATTCCACAACCATGTGTTGTCTTTTT

Coding sequences of Glyma.03G195800

Limit To All Plant Sequences

>Glyma.03g195800.1 sequence-type=CDS polypeptide=Glyma.03g195800.1.p locus=Glyma.03g195800 ID=Glyma.03g195800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
AGAGATACAGAGGTCGCTAATTCGACGCCTGGCGCCGCCATTGGCGACGGCGCGGCGCGATTGAGGCTTCTTCATTCTCTTCTTCTTCTGTTGTTCACCATTGCCACTTCTTCTTCTGATTCTGATCCTGACTTGGAGCCCCTTCACATGACTAAAAACTGCGTTCGAGAACTAGAAGCCAGTGAATCATCAGCAGACAGAAAAATGCTTCCTTTAAGCGTAGAAACTGGTGGATGTGCTGGATTTCAGGTTTTTGAGAGGGATGGAATTAAGTTGGTTGTTGACAATATTTCATATGATTTTGTGAAAGGCGCGACTGTTGACTATGTTGAGGAACTATCTTCGCATTCTTTCCTCCACAGGAAGTTAATGGAAGCAAGATTACCAACATGTGACAGAGAGAAGTCAAGTGAAAGAACTAGCTATTGA

>Glyma.03g195800.2 sequence-type=CDS polypeptide=Glyma.03g195800.2.p locus=Glyma.03g195800 ID=Glyma.03g195800.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
AGAGATACAGAGGTCGCTAATTCGACGCCTGGCGCCGCCATTGGCGACGGCGCGGCGCGATTGAGGCTTCTTCATTCTCTTCTTCTTCTGTTGTTCACCATTGCCACTTCTTCTTCTGATTCTGATCCTGACTTGGAGCCCCTTCACATGACTAAAAACTGCGTTCGAGAACTAGAAGCCAGTGAATCATCAGCAGACAGAAAAATGCTTCCTTTAAGCGTAGAAACTGGTGGATGTGCTGGATTTCAGGTTTTTGAGAGGGATGGAATTAAGTTGGTTGTTGACAATATTTCATATGATTTTGTGAAAGGCGCGACTGTTGACTATGTTGAGGAACTATCTTCGCATTCTTTCCTCCACAGAGTGACATGTTGCATCTTGTTATGTGGATGTTTCAGTGGCACTCCTGACTGA

Predicted protein sequences of Glyma.03G195800

Limit To All Plant Sequences

>Glyma.03g195800.1.p sequence-type=predicted peptide transcript=Glyma.03g195800.1 locus=Glyma.03g195800 ID=Glyma.03g195800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
RDTEVANSTPGAAIGDGAARLRLLHSLLLLLFTIATSSSDSDPDLEPLHMTKNCVRELEASESSADRKMLPLSVETGGCAGFQVFERDGIKLVVDNISYDFVKGATVDYVEELSSHSFLHRKLMEARLPTCDREKSSERTSY*

>Glyma.03g195800.2.p sequence-type=predicted peptide transcript=Glyma.03g195800.2 locus=Glyma.03g195800 ID=Glyma.03g195800.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
RDTEVANSTPGAAIGDGAARLRLLHSLLLLLFTIATSSSDSDPDLEPLHMTKNCVRELEASESSADRKMLPLSVETGGCAGFQVFERDGIKLVVDNISYDFVKGATVDYVEELSSHSFLHRVTCCILLCGCFSGTPD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain