SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.03G103100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.03G103100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.03G103100

Feature Type:gene_model
Chromosome:Gm03
Start:29645105
stop:29646139
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.03G103100
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G04770.2AT 40s ribosomal protein SA B JGI N/AIEA
GO:0000028GO-bp ribosomal small subunit assembly EnsemblGenomesN/AIEA
GO:0000447GO-bp endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) EnsemblGenomesN/AIEA
GO:0000461GO-bp endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) EnsemblGenomesN/AIEA
GO:0006407GO-bp rRNA export from nucleus EnsemblGenomesN/AIEA
GO:0006412GO-bp translation EnsemblGenomesN/AIEA
GO:0015935GO-cc small ribosomal subunit EnsemblGenomesN/AIEA
GO:0022627GO-cc cytosolic small ribosomal subunit EnsemblGenomesN/AIEA
GO:0030686GO-cc 90S preribosome EnsemblGenomesN/AIEA
GO:0003735GO-mf structural constituent of ribosome EnsemblGenomesN/AIEA
PTHR11489Panther 40S RIBOSOMAL PROTEIN SA JGI N/AIEA
PTHR11489:SF7Panther JGI N/AIEA

Expression Patterns of Glyma.03G103100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.03G103100 not represented in the dataset
Glyma.03G103100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.



Coding sequences of Glyma.03G103100
>Glyma.03g103100.1 sequence-type=CDS polypeptide=Glyma.03g103100.1.p locus=Glyma.03g103100 ID=Glyma.03g103100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCCATTGCTACGAATGTCGTCGCCGCCCCACCATGCCAGCTCTTCCAGAAAGAACCCGACATCCAGATGATGTTGGCCGTCGACGTCCACCTCGACACCAAGAACTGCGACTTCCAAATGGAACATAACATCTTCAAGCACCGCAACGACGAGGTTGTTATTATATACATCAATTTGCAAAGTTGCAAACTTTGA
Predicted protein sequences of Glyma.03G103100
>Glyma.03g103100.1.p sequence-type=predicted peptide transcript=Glyma.03g103100.1 locus=Glyma.03g103100 ID=Glyma.03g103100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAIATNVVAAPPCQLFQKEPDIQMMLAVDVHLDTKNCDFQMEHNIFKHRNDEVVIIYINLQSCKL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo