|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G42680.1 | AT | P-loop containing nucleoside triphosphate hydrolases superfamily protein | JGI | N/A | IEA |
| GO:0007018 | GO-bp | microtubule-based movement | EnsemblGenomes | N/A | IEA |
| GO:0016459 | GO-cc | myosin complex | EnsemblGenomes | N/A | IEA |
| GO:0016459 | GO-cc | myosin complex | JGI | N/A | IEA |
| GO:0000166 | GO-mf | nucleotide binding | EnsemblGenomes | N/A | IEA |
| GO:0003774 | GO-mf | motor activity | EnsemblGenomes | N/A | IEA |
| GO:0003774 | GO-mf | motor activity | JGI | N/A | IEA |
| GO:0003777 | GO-mf | microtubule motor activity | EnsemblGenomes | N/A | IEA |
| GO:0003779 | GO-mf | actin binding | EnsemblGenomes | N/A | IEA |
| GO:0005524 | GO-mf | ATP binding | EnsemblGenomes | N/A | IEA |
| GO:0005524 | GO-mf | ATP binding | JGI | N/A | IEA |
| GO:0008017 | GO-mf | microtubule binding | EnsemblGenomes | N/A | IEA |
| PTHR13140 | Panther | MYOSIN | JGI | N/A | IEA |
| PTHR13140:SF37 | Panther | JGI | N/A | IEA | |
| PF00063 | PFAM | Myosin head (motor domain) | JGI | N/A | IEA |
| GN7V-66558 | SoyCyc9-rxn | myosin ATPase | Plant Metabolic Network | ISS |
|
Glyma.03G085200 not represented in the dataset |
Glyma.03G085200 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
>Glyma.03g085200.1 sequence-type=CDS polypeptide=Glyma.03g085200.1.p locus=Glyma.03g085200 ID=Glyma.03g085200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTTGTACATTGCAGATGAAGCGAATCAATCCATTATCATAAGTGGTGAGAGTGGATCTGGGAAAACAGAGACAACAAAAATTGCTATGCAATACTTAGCTGCTCTTGGTGGTAGTTGTTCTGGAATAGAAAATGAAGTTCTCCTGAAAAACTTTATACTAGAAGCTTTTGGGAATGCAAAAACATCTAGGAATGACAACTCTAGCAGATTTGGGAAGTTGATTGAAATTCATTTCAGCACAATGGGGAAAATTTGTGGGGCAAAAATTCAAACTTGTAAGACTGTTTGA
>Glyma.03g085200.1.p sequence-type=predicted peptide transcript=Glyma.03g085200.1 locus=Glyma.03g085200 ID=Glyma.03g085200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MLYIADEANQSIIISGESGSGKTETTKIAMQYLAALGGSCSGIENEVLLKNFILEAFGNAKTSRNDNSSRFGKLIEIHFSTMGKICGAKIQTCKTV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||