SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.03G017900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.03G017900): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.03G017900

Feature Type:gene_model
Chromosome:Gm03
Start:1787790
stop:1800965
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.03G017900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G23010.3AT UDP-galactose transporter 2 JGI N/AIEA
GO:0055085GO-bp transmembrane transport EnsemblGenomesN/AIEA
GO:0055085GO-bp transmembrane transport JGI N/AIEA
GO:1902559GO-bp 3'-phospho-5'-adenylyl sulfate transmembrane transport EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane JGI N/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0030173GO-cc integral component of Golgi membrane EnsemblGenomesN/AIEA
GO:0030176GO-cc integral component of endoplasmic reticulum membrane EnsemblGenomesN/AIEA
GO:0046964GO-mf 3'-phosphoadenosine 5'-phosphosulfate transmembrane transporter activity EnsemblGenomesN/AIEA
PTHR10778Panther SOLUTE CARRIER FAMILY 35 MEMBER B JGI N/AIEA
PTHR10778:SF9Panther JGI N/AIEA
PF08449PFAM UAA transporter family JGI N/AIEA

Expression Patterns of Glyma.03G017900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.03G017900 not represented in the dataset
Glyma.03G017900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.



Coding sequences of Glyma.03G017900
>Glyma.03g017900.1 sequence-type=CDS polypeptide=Glyma.03g017900.1.p locus=Glyma.03g017900 ID=Glyma.03g017900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAAAGCAGCAGAGCAAGCTCGTAGTTTATTTGGAATTTGTCTCTCACACAGACCCAAATGGCAACAATTCCTCATTTGTTCTTCTGGTTTCTTCTTTGGATATCTAGTTAATGGCATATGTGAGAAGAGAGAAAATAATGAGTTTATTGTTTCTTTCTGTTTGTGGAAACGAGGACAAGGTGAGTGGCTTGGAGATCAATCATGCTTTTGGGATTTTCATTGGAAATTTGGGCTCCAATTGTACTATTTCTGCATGCAACTCTACTATGGTTGGTACTTGGCATTTGTTCAAGGATTTGTTTACTTGTTTCTGATTTGTCTCCAAGGGTTCGCAAGGAAGCAAACGGAGATGAACCAATGGAAAACTTATGTGAAGCTTTCTGCTGTACCTATGGTTCCCATGCACGGGGGATCATTGGCTTTCCTTGACTACACAAATCTCAAATCCATGAAAATGGAAATGCTTTTCTGCTCTACTGTGGTGGGATTGCCTTTCTTGATTCCTCCCATGCTTTTCACAGGACAGTTATTCAAAGCATGGACATCATGGTCACGGCATCTATATGTGTATGGAGTATTAGTTATTGAAGCAATGGCCGCATTTATTGGCCAACTCTCTGTGCTGTCACTCATTGCCATTTTTGGAGCTGCCAACACAGCCATGATAACAACGGCAAGAAAGGCAGTGACATTGCTACTATCATACCTCATATTTACAAAACCATTGACAGAACAACATGCAACTGGACTCCTACTCATAGCTATGGGGATTACAATGAAGATATTTCTTGATGACAGATCCAACAAGAAGGCCTTGAACTCTTCTCCAATTGCTAATATTCCAAAACCTTCTGAGGACAAAGAACTGATGGCGCAATCAGATTATGCAGGTGAACATGAAGAAAGCAGACCATTGGTTTAG
Predicted protein sequences of Glyma.03G017900
>Glyma.03g017900.1.p sequence-type=predicted peptide transcript=Glyma.03g017900.1 locus=Glyma.03g017900 ID=Glyma.03g017900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MKAAEQARSLFGICLSHRPKWQQFLICSSGFFFGYLVNGICEKRENNEFIVSFCLWKRGQGEWLGDQSCFWDFHWKFGLQLYYFCMQLYYGWYLAFVQGFVYLFLICLQGFARKQTEMNQWKTYVKLSAVPMVPMHGGSLAFLDYTNLKSMKMEMLFCSTVVGLPFLIPPMLFTGQLFKAWTSWSRHLYVYGVLVIEAMAAFIGQLSVLSLIAIFGAANTAMITTARKAVTLLLSYLIFTKPLTEQHATGLLLIAMGITMKIFLDDRSNKKALNSSPIANIPKPSEDKELMAQSDYAGEHEESRPLV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo