Report for Sequence Feature Glyma.02g262000
| Feature Type: | gene_model |
| Chromosome: | Gm02 |
| Start: | 46626984 |
| stop: | 46627863 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.02g262000
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| PF13456 | Pfam |
Reverse transcriptase-like |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.02g262000 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma02g43000 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.02g262000
>Glyma.02g262000.1 sequence-type=CDS polypeptide=Glyma.02g262000.1.p locus=Glyma.02g262000 id=Glyma.02g262000.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGAGTATATGCAAGCAAAAGGGTATGTTAATGTTATCTTTGAGATGGACAGTAAAGAAGTAGGATACAACTTGAAGAGTTCCAATAGAGATGATTCCGATATAGGATCTGTTATTCAACATTGTAGGAACCTCTTAATTAATTTCAAATAA
>Glyma.02g262000.2 sequence-type=CDS polypeptide=Glyma.02g262000.2.p locus=Glyma.02g262000 id=Glyma.02g262000.2.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGAGTATATGCAAGCAAAAGGGTATGTTAATGTTATCTTTGAGATGGACAGTAAAGAAGTAGGATACAACTTGAAGAGTTCCAATAGAGATGATTCCGATATAGGATCTGTTATTCAACATTGTAGGAACCTCTTAATTAATTTCAAATAA
Predicted protein sequences of Glyma.02g262000
>Glyma.02g262000.1.p sequence-type=predicted peptide transcript=Glyma.02g262000.1 locus=Glyma.02g262000 id=Glyma.02g262000.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MEYMQAKGYVNVIFEMDSKEVGYNLKSSNRDDSDIGSVIQHCRNLLINFK*
>Glyma.02g262000.2.p sequence-type=predicted peptide transcript=Glyma.02g262000.2 locus=Glyma.02g262000 id=Glyma.02g262000.2.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MEYMQAKGYVNVIFEMDSKEVGYNLKSSNRDDSDIGSVIQHCRNLLINFK*