|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT4G24440.1 | AT | transcription initiation factor IIA gamma chain / TFIIA-gamma (TFIIA-S) | JGI | N/A | IEA |
GO:0006351 | GO-bp | transcription, DNA-templated | EnsemblGenomes | N/A | IEA |
GO:0006355 | GO-bp | regulation of transcription, DNA-templated | EnsemblGenomes | N/A | IEA |
GO:0006367 | GO-bp | transcription initiation from RNA polymerase II promoter | EnsemblGenomes | N/A | IEA |
GO:0006367 | GO-bp | transcription initiation from RNA polymerase II promoter | JGI | N/A | IEA |
GO:0045944 | GO-bp | positive regulation of transcription by RNA polymerase II | EnsemblGenomes | N/A | IEA |
GO:0051091 | GO-bp | positive regulation of DNA binding transcription factor activity | EnsemblGenomes | N/A | IEA |
GO:0051123 | GO-bp | RNA polymerase II transcriptional preinitiation complex assembly | EnsemblGenomes | N/A | IEA |
GO:0005634 | GO-cc | nucleus | EnsemblGenomes | N/A | IEA |
GO:0005672 | GO-cc | transcription factor TFIIA complex | EnsemblGenomes | N/A | IEA |
GO:0005672 | GO-cc | transcription factor TFIIA complex | JGI | N/A | IEA |
GO:0003713 | GO-mf | transcription coactivator activity | EnsemblGenomes | N/A | IEA |
GO:0017025 | GO-mf | TBP-class protein binding | EnsemblGenomes | N/A | IEA |
KOG3463 | KOG | Transcription initiation factor IIA, gamma subunit | JGI | N/A | IEA |
PTHR10966 | Panther | TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2 | JGI | N/A | IEA |
PF02268 | PFAM | Transcription initiation factor IIA, gamma subunit, helical domain | JGI | N/A | IEA |
PF02751 | PFAM | Transcription initiation factor IIA, gamma subunit | JGI | N/A | IEA |
Glyma.02g216100 not represented in the dataset |
Glyma.02g216100 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Paralog | Evidence | Comments |
---|---|---|
Glyma.14g183100 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma02g38030 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.02g216100.1 sequence-type=CDS polypeptide=Glyma.02g216100.1.p locus=Glyma.02g216100 ID=Glyma.02g216100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCGACGTTCGAACTGTACCGCAGGTCGACGATCGGAATGTGCCTGACGGAGACGCTGGACGAGATGGTTCAGAACGGCACTCTCAGCCCCGAGCTCGCGATTCAGGTTCTGGTCCAGTTCGATAAGTCCATGACTGAGGCTCTGGAAACACAAGTTAAGAGCAAGGTCTCCATCAAGGGACATCTCCATACATATAGATTTTGCGACAATGTTTGGACCTTCATCTTGCAAGATGCTTTGTTCAAGAACGAAGACAGCCAAGAGAATGTTGGACGGGTTAAAATAGTGGCGTGTGATTCGAAGTTGCTCACACAATAA
>Glyma.02g216100.1.p sequence-type=predicted peptide transcript=Glyma.02g216100.1 locus=Glyma.02g216100 ID=Glyma.02g216100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MATFELYRRSTIGMCLTETLDEMVQNGTLSPELAIQVLVQFDKSMTEALETQVKSKVSIKGHLHTYRFCDNVWTFILQDALFKNEDSQENVGRVKIVACDSKLLTQ*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||