|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G44740.1 | AT | cyclin p4;1 | JGI | N/A | IEA |
| GO:0000079 | GO-bp | regulation of cyclin-dependent protein serine/threonine kinase activity | EnsemblGenomes | N/A | IEA |
| GO:0000079 | GO-bp | regulation of cyclin-dependent protein serine/threonine kinase activity | JGI | N/A | IEA |
| GO:0019901 | GO-mf | protein kinase binding | EnsemblGenomes | N/A | IEA |
| GO:0019901 | GO-mf | protein kinase binding | JGI | N/A | IEA |
| PTHR15615 | Panther | UNCHARACTERIZED | JGI | N/A | IEA |
| PF08613 | PFAM | Cyclin | JGI | N/A | IEA |
|
Glyma.02g177700 not represented in the dataset |
Glyma.02g177700 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma02g30692 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.02g177700.1 sequence-type=CDS polypeptide=Glyma.02g177700.1.p locus=Glyma.02g177700 ID=Glyma.02g177700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGATCGCCTTCCTCTCCTCTCTTCTTGAAAGGGTAGCTGAGTCAAATGATCACAACCAACAGCACCAAAAGATCTCAGTGTTCCATGGCTTGACAAGGCCAAACATCTCAATTCAGAGCTACCTTGAGAGAATCTTCAAGTACGCCAACTGCAGCCCCTCGTGCTTCGTCGTCGCCTACGTCTACCTCGACCGATTCACTCAGAGACAACCCTCCCTTCCCATCAACACCTTCAACGTGCACCGTTTGCTGATCACTAGTGTCATGGTAGCTGCCAAGTTCATGGATGACATCATTATATAG
>Glyma.02g177700.1.p sequence-type=predicted peptide transcript=Glyma.02g177700.1 locus=Glyma.02g177700 ID=Glyma.02g177700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MIAFLSSLLERVAESNDHNQQHQKISVFHGLTRPNISIQSYLERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINTFNVHRLLITSVMVAAKFMDDIII*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||