SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.02g171800

Feature Type:gene_model
Chromosome:Gm02
Start:27104873
stop:27106047
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.02g171800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G34630.1AT geranyl diphosphate synthase 1 JGI N/AIEA
GO:0008299GO-bp isoprenoid biosynthetic process EnsemblGenomesN/AIEA
GO:0008299GO-bp isoprenoid biosynthetic process JGI N/AIEA
PTHR12001Panther GERANYLGERANYL PYROPHOSPHATE SYNTHASE JGI N/AIEA
PTHR12001:SF19Panther JGI N/AIEA
PF00348PFAM Polyprenyl synthetase JGI N/AIEA
PWY-6520SoyCyc9 nonaprenyl diphosphate biosynthesis II Plant Metabolic Network ISS
GN7V-44331SoyCyc9-rxn geranylgeranyl-diphosphate all-trans-nonaprenyl diphosphate synthase Plant Metabolic Network ISS

Expression Patterns of Glyma.02g171800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.02g171800 not represented in the dataset
Glyma.02g171800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.02g171800 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma02g28927 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.02g171800
>Glyma.02g171800.1 sequence-type=CDS polypeptide=Glyma.02g171800.1.p locus=Glyma.02g171800 ID=Glyma.02g171800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTTGTCAAAGGTGGCAAGCCTTATTCATGATGATGTATTGGATGATGCAGATACCAGACGTGGTATTGGTTTGTTGAATTTTTTAATGGACGATATGGTTGTATCTTCAATTGCAAAAGTTGTAGAGCATCTTGTAACTGGGGAGACCATCATGGAATATTATATGCAAAAGACCTACTACAAGACTGCACCTTTAATGTCAAATAGTTGCAAGGCAATGCCCATCCTTGCAGGCCCAACAACAGACGTTGCAATGCTTGCTTTTGAGTATGGAAAAAATCTGGGTTTGGCATTTCAGTTGATAGGTGATGTGCTTGATTTCACAGGCACATCATCTTCCCTTGGAAAGGGTTCTTGTACACATGACTAG
Predicted protein sequences of Glyma.02g171800
>Glyma.02g171800.1.p sequence-type=predicted peptide transcript=Glyma.02g171800.1 locus=Glyma.02g171800 ID=Glyma.02g171800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MLSKVASLIHDDVLDDADTRRGIGLLNFLMDDMVVSSIAKVVEHLVTGETIMEYYMQKTYYKTAPLMSNSCKAMPILAGPTTDVAMLAFEYGKNLGLAFQLIGDVLDFTGTSSSLGKGSCTHD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo