|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G16280.1 | AT | Tetratricopeptide repeat (TPR)-like superfamily protein | JGI | N/A | IEA |
| GO:0006888 | GO-bp | ER to Golgi vesicle-mediated transport | EnsemblGenomes | N/A | IEA |
| GO:0030242 | GO-bp | autophagy of peroxisome | EnsemblGenomes | N/A | IEA |
| GO:0034497 | GO-bp | protein localization to phagophore assembly site | EnsemblGenomes | N/A | IEA |
| GO:0044804 | GO-bp | autophagy of nucleus | EnsemblGenomes | N/A | IEA |
| GO:0000407 | GO-cc | phagophore assembly site | EnsemblGenomes | N/A | IEA |
| GO:0031410 | GO-cc | cytoplasmic vesicle | EnsemblGenomes | N/A | IEA |
| GO:1990072 | GO-cc | TRAPPIII protein complex | EnsemblGenomes | N/A | IEA |
|
Glyma.02g166700 not represented in the dataset |
Glyma.02g166700 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma02g27151 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.02g166700.1 sequence-type=CDS polypeptide=Glyma.02g166700.1.p locus=Glyma.02g166700 ID=Glyma.02g166700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGAAGCCAGAGTTTCCTGCGTGCTTAAAAAAGAGGACATATGCAGTACTAAGTGATGTGTATGCTAATCCTAACATCATGTCTAACACATTCTTTTTGTTTCCAGAGGGCACGTCAATTCAAGGTGAAGCACCCTTCTTGTGGCCTCTTTGGTTTAGGGCTGTTGTTCCTAGTGATATATCACTTTACATGAGCATATATTATGAGATGGGAGATGCATCAAGTGTCATCAAATATCGTACACTTCACTTGCATTACAATCTGCAGGTTAGCATAATGAATATTGAAAGAAACTTTTGGGTTATTATGTGTTTGGGAAATACATCTTAG
>Glyma.02g166700.1.p sequence-type=predicted peptide transcript=Glyma.02g166700.1 locus=Glyma.02g166700 ID=Glyma.02g166700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MKPEFPACLKKRTYAVLSDVYANPNIMSNTFFLFPEGTSIQGEAPFLWPLWFRAVVPSDISLYMSIYYEMGDASSVIKYRTLHLHYNLQVSIMNIERNFWVIMCLGNTS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||