|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G50370.1 | AT | Adenylate kinase family protein | JGI | N/A | IEA |
GO:0006139 | GO-bp | nucleobase-containing compound metabolic process | EnsemblGenomes | N/A | IEA |
GO:0006139 | GO-bp | nucleobase-containing compound metabolic process | JGI | N/A | IEA |
GO:0016310 | GO-bp | phosphorylation | EnsemblGenomes | N/A | IEA |
GO:0005524 | GO-mf | ATP binding | EnsemblGenomes | N/A | IEA |
GO:0005524 | GO-mf | ATP binding | JGI | N/A | IEA |
GO:0016301 | GO-mf | kinase activity | EnsemblGenomes | N/A | IEA |
GO:0016740 | GO-mf | transferase activity | EnsemblGenomes | N/A | IEA |
GO:0019205 | GO-mf | nucleobase-containing compound kinase activity | EnsemblGenomes | N/A | IEA |
GO:0019205 | GO-mf | nucleobase-containing compound kinase activity | JGI | N/A | IEA |
PTHR23359 | Panther | NUCLEOTIDE KINASE | JGI | N/A | IEA |
PF00406 | PFAM | Adenylate kinase | JGI | N/A | IEA |
PWY-7219 | SoyCyc9 | adenosine ribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
PWY-7229 | SoyCyc9 | superpathway of adenosine nucleotides de novo biosynthesis I | Plant Metabolic Network | ISS | |
PWY-841 | SoyCyc9 | superpathway of purine nucleotides de novo biosynthesis I | Plant Metabolic Network | ISS | |
GN7V-63430 | SoyCyc9-rxn | adenylate kinase | Plant Metabolic Network | ISS |
Glyma.02g164900 not represented in the dataset |
Glyma.02g164900 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma02g24818 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.02g164900.1 sequence-type=CDS polypeptide=Glyma.02g164900.1.p locus=Glyma.02g164900 ID=Glyma.02g164900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGAAAAAACCTTCATGTCAGAAAGGTTTCATTCTTGATGGTTTTCCAAGAACCGTGGTCCAAGCACAGAAGCTTGATGAGATGCTGCAAAACCAAGGAGTTAAAGTTAATAAGGTACTCAATTTTGCAATTGATGATGCAATCCTCGAGGAGAGAATTACTGGTCGCTGGATACACACATACAGTGTTCTTGGTGTTGATGATGTTACTGGTGAACCACTTATCCAGTGCAAGGATGACACTGCAGCTGTTCTTAAGTCAAGACTGGAGGCATTTCACAAGCAAACTGAATCG
>Glyma.02g164900.1.p sequence-type=predicted peptide transcript=Glyma.02g164900.1 locus=Glyma.02g164900 ID=Glyma.02g164900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MKKPSCQKGFILDGFPRTVVQAQKLDEMLQNQGVKVNKVLNFAIDDAILEERITGRWIHTYSVLGVDDVTGEPLIQCKDDTAAVLKSRLEAFHKQTES
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||