|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G16570.1 | AT | glutamine synthetase 1;4 | JGI | N/A | IEA |
| GO:0006542 | GO-bp | glutamine biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0006807 | GO-bp | nitrogen compound metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0006807 | GO-bp | nitrogen compound metabolic process | JGI | N/A | IEA |
| GO:0003824 | GO-mf | catalytic activity | EnsemblGenomes | N/A | IEA |
| GO:0004356 | GO-mf | glutamate-ammonia ligase activity | EnsemblGenomes | N/A | IEA |
| GO:0004356 | GO-mf | glutamate-ammonia ligase activity | JGI | N/A | IEA |
| GO:0016874 | GO-mf | ligase activity | EnsemblGenomes | N/A | IEA |
| PTHR20852 | Panther | GLUTAMINE SYNTHETASE | JGI | N/A | IEA |
| PTHR20852:SF14 | Panther | GLUTAMINE SYNTHETASE 2 CYTOPLASMIC | JGI | N/A | IEA |
| PF00120 | PFAM | Glutamine synthetase, catalytic domain | JGI | N/A | IEA |
| GLNSYN-PWY | SoyCyc9 | L-glutamine biosynthesis I | Plant Metabolic Network | ISS | |
| PWY-3282 | SoyCyc9 | superpathway of ammonia assimilation (plants) | Plant Metabolic Network | ISS | |
| PWY-381 | SoyCyc9 | nitrate reduction II (assimilatory) | Plant Metabolic Network | ISS | |
| PWY-6549 | SoyCyc9 | L-glutamine biosynthesis III | Plant Metabolic Network | ISS | |
| PWY-6963 | SoyCyc9 | ammonia assimilation cycle I | Plant Metabolic Network | ISS | |
| PWY-6964 | SoyCyc9 | ammonia assimilation cycle II | Plant Metabolic Network | ISS | |
| PWY-7060 | SoyCyc9 | ornithine-citrulline shuttle | Plant Metabolic Network | ISS | |
| GN7V-56947 | SoyCyc9-rxn | glutamate-ammonia ligase | Plant Metabolic Network | ISS |
|
Glyma.02g127500 not represented in the dataset |
Glyma.02g127500 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma02g14125 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.02g127500.1 sequence-type=CDS polypeptide=Glyma.02g127500.1.p locus=Glyma.02g127500 ID=Glyma.02g127500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCAGCCAAACCCTTGCCAGTTTCATAATGTGAATTTAATTACTTATTCCTTCATATTTCAGGGTCCTTATTATTGCAGTGCTGGGACAGATAAGTCATTTGGACGTGACATATCTGATGCTCATTACAAGGCTTGCTTATATGCTGGAATTAACATCAGTGGCACCAATGGGGAGATTATGCCAGGGCAGTGGGAGTACCAAGTTGGTCCTAGTGTAGGTATTGAGGCTGGTGATCATATCTGGGCTTCAAGGTACATCCTCGAGGTAATTTATTACTGCTTATACTAA
>Glyma.02g127500.1.p sequence-type=predicted peptide transcript=Glyma.02g127500.1 locus=Glyma.02g127500 ID=Glyma.02g127500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MQPNPCQFHNVNLITYSFIFQGPYYCSAGTDKSFGRDISDAHYKACLYAGINISGTNGEIMPGQWEYQVGPSVGIEAGDHIWASRYILEVIYYCLY*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||