SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.02g127500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.02g127500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.02g127500

Feature Type:gene_model
Chromosome:Gm02
Start:12959589
stop:12960575
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G16570.1AT glutamine synthetase 1;4 JGI N/AIEA
GO:0006542GO-bp glutamine biosynthetic process EnsemblGenomesN/AIEA
GO:0006807GO-bp nitrogen compound metabolic process EnsemblGenomesN/AIEA
GO:0006807GO-bp nitrogen compound metabolic process JGI N/AIEA
GO:0003824GO-mf catalytic activity EnsemblGenomesN/AIEA
GO:0004356GO-mf glutamate-ammonia ligase activity EnsemblGenomesN/AIEA
GO:0004356GO-mf glutamate-ammonia ligase activity JGI N/AIEA
GO:0016874GO-mf ligase activity EnsemblGenomesN/AIEA
PTHR20852Panther GLUTAMINE SYNTHETASE JGI N/AIEA
PTHR20852:SF14Panther GLUTAMINE SYNTHETASE 2 CYTOPLASMIC JGI N/AIEA
PF00120PFAM Glutamine synthetase, catalytic domain JGI N/AIEA
GLNSYN-PWYSoyCyc9 L-glutamine biosynthesis I Plant Metabolic Network ISS
PWY-3282SoyCyc9 superpathway of ammonia assimilation (plants) Plant Metabolic Network ISS
PWY-381SoyCyc9 nitrate reduction II (assimilatory) Plant Metabolic Network ISS
PWY-6549SoyCyc9 L-glutamine biosynthesis III Plant Metabolic Network ISS
PWY-6963SoyCyc9 ammonia assimilation cycle I Plant Metabolic Network ISS
PWY-6964SoyCyc9 ammonia assimilation cycle II Plant Metabolic Network ISS
PWY-7060SoyCyc9 ornithine-citrulline shuttle Plant Metabolic Network ISS
GN7V-56947SoyCyc9-rxn glutamate-ammonia ligase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.02g127500 not represented in the dataset

Glyma.02g127500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma02g14125 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.02g127500.1 sequence-type=CDS polypeptide=Glyma.02g127500.1.p locus=Glyma.02g127500 ID=Glyma.02g127500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCAGCCAAACCCTTGCCAGTTTCATAATGTGAATTTAATTACTTATTCCTTCATATTTCAGGGTCCTTATTATTGCAGTGCTGGGACAGATAAGTCATTTGGACGTGACATATCTGATGCTCATTACAAGGCTTGCTTATATGCTGGAATTAACATCAGTGGCACCAATGGGGAGATTATGCCAGGGCAGTGGGAGTACCAAGTTGGTCCTAGTGTAGGTATTGAGGCTGGTGATCATATCTGGGCTTCAAGGTACATCCTCGAGGTAATTTATTACTGCTTATACTAA

>Glyma.02g127500.1.p sequence-type=predicted peptide transcript=Glyma.02g127500.1 locus=Glyma.02g127500 ID=Glyma.02g127500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MQPNPCQFHNVNLITYSFIFQGPYYCSAGTDKSFGRDISDAHYKACLYAGINISGTNGEIMPGQWEYQVGPSVGIEAGDHIWASRYILEVIYYCLY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo