SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.02g121500

Feature Type:gene_model
Chromosome:Gm02
Start:12065640
stop:12082937
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.02g121500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G15800.1AT K-box region and MADS-box transcription factor family protein JGI N/AIEA
GO:0006351GO-bp transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated JGI N/AIEA
GO:0045944GO-bp positive regulation of transcription by RNA polymerase II EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus JGI N/AIEA
GO:0000977GO-mf RNA polymerase II regulatory region sequence-specific DNA binding EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding EnsemblGenomesN/AIEA
GO:0003677GO-mf DNA binding JGI N/AIEA
GO:0003700GO-mf DNA binding transcription factor activity EnsemblGenomesN/AIEA
GO:0003700GO-mf sequence-specific DNA binding transcription factor activity JGI N/AIEA
GO:0046983GO-mf protein dimerization activity EnsemblGenomesN/AIEA
GO:0046983GO-mf protein dimerization activity JGI N/AIEA
KOG0014 KOG MADS box transcription factor JGI N/AIEA
PTHR11945Panther MADS BOX PROTEIN JGI N/AIEA
PTHR11945:SF19Panther JGI N/AIEA
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI N/AIEA
PF01486PFAM K-box region JGI N/AIEA

Expression Patterns of Glyma.02g121500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.02g121500 not represented in the dataset
Glyma.02g121500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.02g121500
ParalogEvidenceComments
Glyma.01g064100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.02g121500 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma02g13401 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.02g121500
>Glyma.02g121500.1 sequence-type=CDS polypeptide=Glyma.02g121500.1.p locus=Glyma.02g121500 ID=Glyma.02g121500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGTAGGGGAAAGGTGGAGCTGAAGAGGATTGAGAACAAGATAAACCGTCAAGTGACATTTGCAAAGAGGAGGAATGGTTTGCTCAAAAAGGCTTATGAACTCTCTGTCCTCTGTGATGCTGAGGTTGCCCTTATTATCTTCTCCAACCGTGGCAAGCTGTATGAGTTCTGCAGCGGCCATAGCATGGCCAAGACACTTGAACGGTATCACAGATGCAGTTATGGAGCCTTGGAAGTCCAGCACCAACCTGAAATAGAGACACAGAGGCGCTACCAAGAGTACCTGAAGCTAAAATCCAGAGTTGAGGCACTACAGCAAACACAAAGAAACCTCCTTGGGGAAGAATTGGAGCACTTAGACGTTAAGGACCTTGAGCAGCTTGAACGTCAGCTGGACTCTTCCCTGAAGCAAATCAGGTCAAACAAGACACAACAAATGCTCGATCAACTCGCTGATTTGCATAGAAAGGAAGAGATGCTACTGGAGACTAACAATATCCTGAGGAACAAGTTGGAGGAAATCAATGTAGCCCTTCAACCAACATGGGAAACTAGGGAGCAAAATGCTCCATACAATTACCACCCTTCCCAATCAGAGGGATATTATGAGACAGCACATTGCAACAGTACATTGCGAATTGGCTATGATTCTTCAGGGTTAAATGAAGCAGGAGGAGCTGCAGGAACCTCAGCCCAAAATGCTAGTGAATTCATGAATGGATGGATGAACTAA
Predicted protein sequences of Glyma.02g121500
>Glyma.02g121500.1.p sequence-type=predicted peptide transcript=Glyma.02g121500.1 locus=Glyma.02g121500 ID=Glyma.02g121500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGRGKVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCSGHSMAKTLERYHRCSYGALEVQHQPEIETQRRYQEYLKLKSRVEALQQTQRNLLGEELEHLDVKDLEQLERQLDSSLKQIRSNKTQQMLDQLADLHRKEEMLLETNNILRNKLEEINVALQPTWETREQNAPYNYHPSQSEGYYETAHCNSTLRIGYDSSGLNEAGGAAGTSAQNASEFMNGWMN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo