Report for Sequence Feature Glyma.02g111200
| Feature Type: | gene_model |
| Chromosome: | Gm02 |
| Start: | 10683923 |
| stop: | 10684431 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Gene model name correspondences to Glyma.02g111200 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.02g111200
>Glyma.02g111200.1 sequence-type=CDS polypeptide=Glyma.02g111200.1.p locus=Glyma.02g111200 id=Glyma.02g111200.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGTTGATTTTGCCTTGGTGTTCAGTTTTCTACCATGTACCAAACACGAAAGTGAAAGAATTGATGGATGGGTACAACATTTTTGGCTTCTCAAAGGTAAACTTAATTAATCAAGTAGTTGTGGAATTTTGTGGAAAAAAAAACTAG
Predicted protein sequences of Glyma.02g111200
>Glyma.02g111200.1.p sequence-type=predicted peptide transcript=Glyma.02g111200.1 locus=Glyma.02g111200 id=Glyma.02g111200.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MLILPWCSVFYHVPNTKVKELMDGYNIFGFSKVNLINQVVVEFCGKKN*