Glyma.02g087800

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.02g087800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.02g087800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.02g087800

Feature Type:	gene_model
Chromosome:	Gm02
Start:	7676883
stop:	7680136
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.02g087800

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G51110.1	AT	Transcriptional coactivator/pterin dehydratase	JGI	N/A	IEA
GO:0006729	GO-bp	tetrahydrobiopterin biosynthetic process	EnsemblGenomes	N/A	IEA
GO:0006729	GO-bp	tetrahydrobiopterin biosynthetic process	JGI	N/A	IEA
GO:0008124	GO-mf	4-alpha-hydroxytetrahydrobiopterin dehydratase activity	EnsemblGenomes	N/A	IEA
GO:0008124	GO-mf	4-alpha-hydroxytetrahydrobiopterin dehydratase activity	JGI	N/A	IEA
KOG4073	KOG	Pterin carbinolamine dehydratase PCBD/dimerization cofactor of HNF1	JGI	N/A	IEA
PTHR12599	Panther	PTERIN-4-ALPHA-CARBINOLAMINE DEHYDRATASE	JGI	N/A	IEA
PF01329	PFAM	Pterin 4 alpha carbinolamine dehydratase	JGI	N/A	IEA
PWY-7158	SoyCyc9	L-phenylalanine degradation V	Plant Metabolic Network		ISS
GN7V-66126	SoyCyc9-rxn	4a-hydroxytetrahydrobiopterin dehydratase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.02g087800

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.02g087800 not represented in the dataset	Glyma.02g087800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.02g087800

Paralog	Evidence	Comments
Glyma.10g117200	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.02g087800 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma02g09640	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.02g087800

Limit To All Plant Sequences

>Glyma.02g087800.1 sequence-type=CDS polypeptide=Glyma.02g087800.1.p locus=Glyma.02g087800 ID=Glyma.02g087800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCCATCACAGGCAACCTCAACCTCAACCTAGTACTCCCCGTGGCACGCCCCATGGCGTGCCCCCCACGCGCCCCAACGTCCCTCCTCGCTCGTGGCCGTGGCGCGTCGTCGTCACCTTCGCTCCTGGTCACGCGCGCCATCGACGTGAACGAGTTCCTGGGGGACTTCGGGGCGCGGGACCCTTTCCCCGCGGAGCTTGAGAGTTCCTTCGGGGAGAAAGTGCTGGGATACAGCAACACCGAGCACAAAATCCTCATCCCCACCATCACTGCTCTCGCCCTCTCGCAGCAGGAGTGTGCTCCCGTTTCCCCTTCGCAGCCCCCCATCTCGCTGGATGACGCCCAGACGCTCATTAGAAAGGTTGTGGGTTGGAGACTTGTGAATGAGGAAGGTGGACTTAAAATTCAATGCTTGTGGAAGTTAAGAGATTTTAAATGTGGGGTTGAACTCATTAACAGGATCTCTAAGGTTGTTGAGGCTTTGGGCCATTTCCCAAATATCTACTTGGAGCAACCAAATCAAGTCAGAGCAGAACTATGGACAGCTTCCATTGGAGGTTTAACTATGAATGATTTTATTGTTGCTGCAAAGATAGATGAGATAAAGACATCAGATCTTGTCCCAAGGAAAAGGGTTTGGGCGTAA

Predicted protein sequences of Glyma.02g087800

Limit To All Plant Sequences

>Glyma.02g087800.1.p sequence-type=predicted peptide transcript=Glyma.02g087800.1 locus=Glyma.02g087800 ID=Glyma.02g087800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAITGNLNLNLVLPVARPMACPPRAPTSLLARGRGASSSPSLLVTRAIDVNEFLGDFGARDPFPAELESSFGEKVLGYSNTEHKILIPTITALALSQQECAPVSPSQPPISLDDAQTLIRKVVGWRLVNEEGGLKIQCLWKLRDFKCGVELINRISKVVEALGHFPNIYLEQPNQVRAELWTASIGGLTMNDFIVAAKIDEIKTSDLVPRKRVWA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain