Report for Sequence Feature Glyma.02g087300
| Feature Type: | gene_model |
| Chromosome: | Gm02 |
| Start: | 7571476 |
| stop: | 7571676 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.02g087300
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT5G31412.1 | AT |
|
JGI | N/A | IEA |
| PTHR32166 | PantherFam |
OSJNBA0013A04.12 PROTEIN |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.02g087300 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.02g087300
>Glyma.02g087300.1 sequence-type=CDS polypeptide=Glyma.02g087300.1.p locus=Glyma.02g087300 id=Glyma.02g087300.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGTGGATGGATGTAAGGAGACACGTGAATGTGGAGTTTGCAAATTTTTCTAATGGAAGAGAAGGCTTTTATGATGTTTACTCTTTAAGGGATAGAGGTATATTGGATGCAAAATATTGGTGGCTAGTTCATGATGCTCATGCACCAATACTTCAAAAGATTGCCCTTAAGCTACTTGGGCAAACATGTTCATCTTCATGA
Predicted protein sequences of Glyma.02g087300
>Glyma.02g087300.1.p sequence-type=predicted peptide transcript=Glyma.02g087300.1 locus=Glyma.02g087300 id=Glyma.02g087300.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MWMDVRRHVNVEFANFSNGREGFYDVYSLRDRGILDAKYWWLVHDAHAPILQKIALKLLGQTCSSS*