Report for Sequence Feature Glyma.02g012700
Feature Type: gene_model
Chromosome: Gm02
Start: 1131586
stop: 1133118
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.02g012700
Proteins Associated with Glyma.02g012700
Locus Gene Symbol Protein Name
BZIP60 bZIP transcription factor bZIP60
bZIP8 Basic leucine zipper transcription factor-like protein gene 8
Expression Patterns of Glyma.02g012700
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.02g012700
Paralog Evidence Comments
Glyma.10g013300 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.02g012700 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma02g01600 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.02g012700
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.02g012700.1 sequence-type=CDS polypeptide=Glyma.02g012700.1.p locus=Glyma.02g012700 ID=Glyma.02g012700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTTCGATTCAACGCCCGGCGAGTTCGGGATCGTCGGAGGGAGGAGATCCGGTGATGTACGAGAGGAAGAGGAAGCGTATGGAGTCGAACCGCGAGTCCGCCCGGCGATCGCGGATGAAGAAGCAGAAGCAGCTCGAAGACCTAACCGACGAAGTGAGCCGATTGGAAGGCGAGAACGCGCGTTTGGCGCCGAGCATAAAAGTGAAGGAGGAAGCGTACGTTGAGATGGAGGCCGCCAACGACATCCTCAGAGCACAGACCATGGAACTCGCCGACCGGTTAAGGTTTCTGAACTCCATTATTGAGATCGCCGATGAGGTCGGCGGCGAATCCTTCGAGATTCCGCAGATTCCGGACCCTCTCTTCATGCCCTGGCAGATCCCCCACCCTATGATGGCAACGCCGCCTGACATGTTCTTCCATGGAAATGAAGGCCTGTTTGCTTGA
Predicted protein sequences of Glyma.02g012700
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.02g012700.1.p sequence-type=predicted peptide transcript=Glyma.02g012700.1 locus=Glyma.02g012700 ID=Glyma.02g012700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASIQRPASSGSSEGGDPVMYERKRKRMESNRESARRSRMKKQKQLEDLTDEVSRLEGENARLAPSIKVKEEAYVEMEAANDILRAQTMELADRLRFLNSIIEIADEVGGESFEIPQIPDPLFMPWQIPHPMMATPPDMFFHGNEGLFA*