|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G55810.2 | AT | nicotinate/nicotinamide mononucleotide adenyltransferase | JGI | N/A | IEA |
| GO:0009058 | GO-bp | biosynthetic process | JGI | N/A | IEA |
| GO:0034628 | GO-bp | 'de novo' NAD biosynthetic process from aspartate | EnsemblGenomes | N/A | IEA |
| GO:0000309 | GO-mf | nicotinamide-nucleotide adenylyltransferase activity | EnsemblGenomes | N/A | IEA |
| GO:0003824 | GO-mf | catalytic activity | JGI | N/A | IEA |
| GO:0004515 | GO-mf | nicotinate-nucleotide adenylyltransferase activity | EnsemblGenomes | N/A | IEA |
| PTHR12039 | Panther | NICOTINAMIDE MONONUCLEOTIDE ADENYLYLTRANSFERASE | JGI | N/A | IEA |
| PF01467 | PFAM | Cytidylyltransferase | JGI | N/A | IEA |
| PWY-5381 | SoyCyc9 | pyridine nucleotide cycling (plants) | Plant Metabolic Network | ISS | |
| PYRIDNUCSYN-PWY | SoyCyc9 | NAD biosynthesis I (from aspartate) | Plant Metabolic Network | ISS | |
| GN7V-46041 | SoyCyc9-rxn | nicotinate-nucleotide adenylyltransferase | Plant Metabolic Network | ISS |
|
Glyma.02G300600 not represented in the dataset |
Glyma.02G300600 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.14g013400 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.02g300600 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma02g47011 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.02g300600.1 sequence-type=CDS polypeptide=Glyma.02g300600.1.p locus=Glyma.02g300600 ID=Glyma.02g300600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCTTCTCTGTGGTTCTGATCTCCTTCATTCTTTTGGCATTCCTGGATTCTGGATTCCTGACCAGGTTAAAACTATATGCAAAGATTATAGAGTAGTCTGCATTCGCAGAGAAGGACAAGATGTAGAGAAGACTATATCTAAAGATGAAATTCTGAATGAGAATAAGGATAATATCAAAGTTGTGGATGAACTTGTTCCAAATCAAATCAGCTCAACCAGAGGATTGCATGCAAGAGGACTATCTATAAAATACCTTACTGCGGATGAAGTGATTGATTATGTCAGAGAGCAACAATTATACTTGAACTTAAATGATAAATGA
>Glyma.02g300600.1.p sequence-type=predicted peptide transcript=Glyma.02g300600.1 locus=Glyma.02g300600 ID=Glyma.02g300600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MLLCGSDLLHSFGIPGFWIPDQVKTICKDYRVVCIRREGQDVEKTISKDEILNENKDNIKVVDELVPNQISSTRGLHARGLSIKYLTADEVIDYVREQQLYLNLNDK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||