SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.02G199400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.02G199400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.02G199400

Feature Type:gene_model
Chromosome:Gm02
Start:38257249
stop:38257803
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G30960.1AT SOS3-interacting protein 3 JGI N/AIEA
GO:0006468GO-bp protein phosphorylation EnsemblGenomesN/AIEA
GO:0006468GO-bp protein phosphorylation JGI N/AIEA
GO:0018105GO-bp peptidyl-serine phosphorylation EnsemblGenomesN/AIEA
GO:0018107GO-bp peptidyl-threonine phosphorylation EnsemblGenomesN/AIEA
GO:0035556GO-bp intracellular signal transduction EnsemblGenomesN/AIEA
GO:0005622GO-cc intracellular EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0004672GO-mf protein kinase activity EnsemblGenomesN/AIEA
GO:0004672GO-mf protein kinase activity JGI N/AIEA
GO:0004674GO-mf protein serine/threonine kinase activity EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding JGI N/AIEA
PTHR24343Panther SERINE/THREONINE KINASE JGI N/AIEA
PTHR24343:SF45Panther JGI N/AIEA
PF00069PFAM Protein kinase domain JGI N/AIEA

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.02G199400 not represented in the dataset

Glyma.02G199400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma02g35951 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.02g199400.1 sequence-type=CDS polypeptide=Glyma.02g199400.1.p locus=Glyma.02g199400 ID=Glyma.02g199400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAAGGTGGTGGGAAAAGAAAAGGTGATAAAGGTCGGAATGATGGAGCAGGTGAAGAAGGAGATCTCGGTGATGAAGATGGTGAAGCACCAAAACATCGTCGAACTCCACGAAGTCATGGCCAGCAAGTCCAAGATCTATATTGCCATGGAACTCGTCCGCGGCGGAGAGCTCTTCAACAAGGTCTCTAAAGGCCGCTTAAAGGAGGACGTGGCAAGACTTTACTTCCAGCCGTTAATCTCCGCCGTCGACTTCTGCCACAGTCGTGGCGTCTACCACCGCGACCTCAAGCCGGAAAACCTCCTCCTGGACGAACACGACAACCTCAAAGTCTCCGACTTCGGACTCACCGCTTTCTCCGAACACCTCAAGGAGGACGGGCTGTTACACACCACGTGCGGCATGCCTGCGTCACCTGAAGTGATAGCGAAAAAAGGCTATGACGGTGCCAAGGCTGACATATGGTCATGTGGTGTAATCCTCTACGTTCTCCTCGCAGGCTTTTTACCCTTTCAGGATGATAATTTGGTTGCCATGATAATTTGGTGGGGTTAA

>Glyma.02g199400.1.p sequence-type=predicted peptide transcript=Glyma.02g199400.1 locus=Glyma.02g199400 ID=Glyma.02g199400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MKVVGKEKVIKVGMMEQVKKEISVMKMVKHQNIVELHEVMASKSKIYIAMELVRGGELFNKVSKGRLKEDVARLYFQPLISAVDFCHSRGVYHRDLKPENLLLDEHDNLKVSDFGLTAFSEHLKEDGLLHTTCGMPASPEVIAKKGYDGAKADIWSCGVILYVLLAGFLPFQDDNLVAMIIWWG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo