SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.02G198400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.02G198400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.02G198400

Feature Type:gene_model
Chromosome:Gm02
Start:37991738
stop:37995375
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G06290.1AT 2-cysteine peroxiredoxin B JGI N/AIEA
GO:0045454GO-bp cell redox homeostasis EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process JGI N/AIEA
GO:0098869GO-bp cellular oxidant detoxification EnsemblGenomesN/AIEA
GO:0005623GO-cc cell EnsemblGenomesN/AIEA
GO:0016209GO-mf antioxidant activity EnsemblGenomesN/AIEA
GO:0016209GO-mf antioxidant activity JGI N/AIEA
GO:0016491GO-mf oxidoreductase activity EnsemblGenomesN/AIEA
GO:0016491GO-mf oxidoreductase activity JGI N/AIEA
GO:0051920GO-mf peroxiredoxin activity EnsemblGenomesN/AIEA
GO:0051920GO-mf peroxiredoxin activity JGI N/AIEA
KOG0852 KOG Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes JGI N/AIEA
PTHR10681Panther THIOREDOXIN PEROXIDASE JGI N/AIEA
PF00578PFAM AhpC/TSA family JGI N/AIEA
PF10417PFAM C-terminal domain of 1-Cys peroxiredoxin JGI N/AIEA
GN7V-44949SoyCyc9-rxn peroxiredoxin Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.02G198400 not represented in the dataset

Glyma.02G198400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.10g078400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.02g198400 Wm82.a4.v1ISS As supplied by JGI
Glyma02g35780 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.02g198400.1 sequence-type=CDS polypeptide=Glyma.02g198400.1.p locus=Glyma.02g198400 ID=Glyma.02g198400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCATGCTCAGCCACCTCTGCTTCCCTCTTCTCCGCAAACCCAACACCCCTCTTCTCTCCCAAACCCTCTCTCTCCCTCCACCTTAACCCTCTCCCCACGCGCCCTTCTCCCTCCCTCACGCGCCCTTCTCTCTCCCTCACGCGCCCTTCTCACTCTCGCCGCTCCTTCGTTGTCAAAGCCTCCTCCAGCGAGCTTCCGCTGGTTGGTAACACCGCACCGGATTTCGAAGCAGAGGCTGTGTTTGACCAGGAGTTTATCAACGTGAAACTATCTGATTACATTGGGAAGAAATATGTTGTGCTCTTCTTCTACCCGTTGGACTTCACCTTTGTCTGCCCCACAGAAATCACTGCTTTCAGTGACCGACATGCAGAGTTCGAGGCACTAAATACTGAGATATTGGGTGTTTCAGTTGACAGTGTGTTCTCGCACCTTGCATGGATCCAAACAGATAGAAAGTCAGGTGGCCTTGGTGACTTGAACTATCCTTTGATTTCTGATGTCACCAAATCCATATCGAAATCTTATGGTGTTCTCATTCCTGATCAGGGAATTGCATTGAGAGGATTGTTCATTATTGACAAGGAAGGGGTTATTCAGCATTCTACCATTAACAACTTGGCAATTGGTAGAAGTGTTGACGAGACAAAGAGAACTCTCCAGGCCTTACAGTATGTGCAGGAGAACCCAGATGAAGTTTGCCCTGCTGGGTGGAAGCCTGGGGAGAAGTCCATGAAACCAGACCCTAAACTTAGCAAAGACTACTTTGCAGCGGTGTAG

>Glyma.02g198400.1.p sequence-type=predicted peptide transcript=Glyma.02g198400.1 locus=Glyma.02g198400 ID=Glyma.02g198400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MACSATSASLFSANPTPLFSPKPSLSLHLNPLPTRPSPSLTRPSLSLTRPSHSRRSFVVKASSSELPLVGNTAPDFEAEAVFDQEFINVKLSDYIGKKYVVLFFYPLDFTFVCPTEITAFSDRHAEFEALNTEILGVSVDSVFSHLAWIQTDRKSGGLGDLNYPLISDVTKSISKSYGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETKRTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKDYFAAV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo