Report for Sequence Feature Glyma.02G142000
Feature Type: gene_model
Chromosome: Gm02
Start: 14666976
stop: 14667899
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.02G142000
Proteins Associated with Glyma.02G142000
Locus Gene Symbol Protein Name
GSH1 gamma glutamylcysteine synthestase
Expression Patterns of Glyma.02G142000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Gene model name correspondences to Glyma.02G142000 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma02g16030 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.02G142000
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.02g142000.1 sequence-type=CDS polypeptide=Glyma.02g142000.1.p locus=Glyma.02g142000 ID=Glyma.02g142000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAGGGAGAAGCATTAGTAAAAACGCTGTTTCAGGATAACCCAAAAAACCTGATTATAGGATTGCACCCAGTATTCAATAATACAGAAACTGTTGAAAAAGTAGCTGTTCCTTCTGCTGTATTTTCTCAACCACCAATTGGACAAGTTGGTCTTACTGAGGAACAGGCCGTACAACAATATGGAGATATTGACATCTTCACTGCAAATTTTAGGCCGCTGAAAGCTACTCTCTCTGGGCTTCCAGACCGGGTTTTTATGAAATTAGTAGTCTGTGCAAAAACAAATGAAGTTCTAGGTTTGCATATGTGTGGAGAAGATGCTCCTGAAATTGTGCAAATTTTTGTACTATTATTCTTTGATGACAAGTTATAG
Predicted protein sequences of Glyma.02G142000
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.02g142000.1.p sequence-type=predicted peptide transcript=Glyma.02g142000.1 locus=Glyma.02g142000 ID=Glyma.02g142000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MEGEALVKTLFQDNPKNLIIGLHPVFNNTETVEKVAVPSAVFSQPPIGQVGLTEEQAVQQYGDIDIFTANFRPLKATLSGLPDRVFMKLVVCAKTNEVLGLHMCGEDAPEIVQIFVLLFFDDKL*