|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G56350.1 | AT | Pyruvate kinase family protein | JGI | N/A | IEA |
| GO:0006096 | GO-bp | glycolytic process | EnsemblGenomes | N/A | IEA |
| GO:0006096 | GO-bp | glycolysis | JGI | N/A | IEA |
| GO:0016310 | GO-bp | phosphorylation | EnsemblGenomes | N/A | IEA |
| GO:0000287 | GO-mf | magnesium ion binding | EnsemblGenomes | N/A | IEA |
| GO:0000287 | GO-mf | magnesium ion binding | JGI | N/A | IEA |
| GO:0003824 | GO-mf | catalytic activity | EnsemblGenomes | N/A | IEA |
| GO:0004743 | GO-mf | pyruvate kinase activity | EnsemblGenomes | N/A | IEA |
| GO:0004743 | GO-mf | pyruvate kinase activity | JGI | N/A | IEA |
| GO:0016301 | GO-mf | kinase activity | EnsemblGenomes | N/A | IEA |
| GO:0016740 | GO-mf | transferase activity | EnsemblGenomes | N/A | IEA |
| GO:0030955 | GO-mf | potassium ion binding | EnsemblGenomes | N/A | IEA |
| GO:0030955 | GO-mf | potassium ion binding | JGI | N/A | IEA |
| PTHR11817 | Panther | PYRUVATE KINASE | JGI | N/A | IEA |
| PF00224 | PFAM | Pyruvate kinase, barrel domain | JGI | N/A | IEA |
| GLYCOLYSIS | SoyCyc9 | glycolysis I (from glucose 6-phosphate) | Plant Metabolic Network | ISS | |
| PWY-1042 | SoyCyc9 | glycolysis IV (plant cytosol) | Plant Metabolic Network | ISS | |
| PWY-5464 | SoyCyc9 | superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle | Plant Metabolic Network | ISS | |
| PWY-5484 | SoyCyc9 | glycolysis II (from fructose 6-phosphate) | Plant Metabolic Network | ISS | |
| PWY-5723 | SoyCyc9 | Rubisco shunt | Plant Metabolic Network | ISS | |
| PWY-7345 | SoyCyc9 | superpathway of anaerobic sucrose degradation | Plant Metabolic Network | ISS | |
| GN7V-53932 | SoyCyc9-rxn | pyruvate kinase | Plant Metabolic Network | ISS |
|
Glyma.02G071100 not represented in the dataset |
Glyma.02G071100 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.02g071100 | Wm82.a4.v1 | ISS | As supplied by JGI |
>Glyma.02g071100.1 sequence-type=CDS polypeptide=Glyma.02g071100.1.p locus=Glyma.02g071100 ID=Glyma.02g071100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGAAAATTCAATTGAGAAGATCTTTCTTGCTCAGAAAGTAATGATACACAAGTCAAACATGCAAGGCAAGCCTGTGGTGACAGCCACCCAGATGTTAGAGTCCATGATCAAATCTCCCCGGCCTACGCGAGCCGAGGCCACCGATGTTGCTAATGCAGTCCTTGATGGCACAGACTGTGTTATGCTTAGCGGGGAAACTTCTGCAGGAGCCTATCCAGACATTGCTGTTCAAACCATGGCCAGCTCCAACTCCAATGAGTCCTTTGGAGAGCATGGCTTCGGCCGCAGTTAG
>Glyma.02g071100.1.p sequence-type=predicted peptide transcript=Glyma.02g071100.1 locus=Glyma.02g071100 ID=Glyma.02g071100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MENSIEKIFLAQKVMIHKSNMQGKPVVTATQMLESMIKSPRPTRAEATDVANAVLDGTDCVMLSGETSAGAYPDIAVQTMASSNSNESFGEHGFGRS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||