|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G39950.1 | AT | thioredoxin 2 | JGI | N/A | IEA |
| GO:0006662 | GO-bp | glycerol ether metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0034599 | GO-bp | cellular response to oxidative stress | EnsemblGenomes | N/A | IEA |
| GO:0045454 | GO-bp | cell redox homeostasis | EnsemblGenomes | N/A | IEA |
| GO:0045454 | GO-bp | cell redox homeostasis | JGI | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0098869 | GO-bp | cellular oxidant detoxification | EnsemblGenomes | N/A | IEA |
| GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
| GO:0004791 | GO-mf | thioredoxin-disulfide reductase activity | EnsemblGenomes | N/A | IEA |
| GO:0015035 | GO-mf | protein disulfide oxidoreductase activity | EnsemblGenomes | N/A | IEA |
| GO:0016671 | GO-mf | oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor | EnsemblGenomes | N/A | IEA |
| GO:0047134 | GO-mf | protein-disulfide reductase activity | EnsemblGenomes | N/A | IEA |
| KOG0907 | KOG | Thioredoxin | JGI | N/A | IEA |
| PTHR10438 | Panther | THIOREDOXIN | JGI | N/A | IEA |
| PF00085 | PFAM | Thioredoxin | JGI | N/A | IEA |
| GN7V-50328 | SoyCyc9-rxn | monodehydroascorbate reductase (NADH) | Plant Metabolic Network | ISS |
|
Glyma.02G023000 not represented in the dataset |
Glyma.02G023000 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.01g041200 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.02g023000 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma02g02700 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.02g023000.1 sequence-type=CDS polypeptide=Glyma.02g023000.1.p locus=Glyma.02g023000 ID=Glyma.02g023000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGGAGCCAAGTTTTCCACTTTTGAGTTTGTTGAAAAATCATCACATTCATCATCCCTGATCCTCACCTTCCATTCCACTGCTAAATGGAAGGCTCACTTTGATGTCTCCAAAGAAACAAACAAGCTGATGGTTATCGACTTCACCGCTACGTGGTGTGGACCTTGCAAATACATGGACCCAATTATCAAAAATTTTGCTGCAAAATACACAGACGTGGAGTTCATTAAGATTGATGTGGATGAGCTAATGGAGGTGGCCCAGGCTTTCCAGGTGCAAGCAATGCCAACATTTATACTAATTAAAAAAGGGAAAGTAGTGGAAAAGGTGGTGGGAGCCAAAAAGGAGGAGCTGCAGAAACTGATTGATAAACACAGGAATTGA
>Glyma.02g023000.1.p sequence-type=predicted peptide transcript=Glyma.02g023000.1 locus=Glyma.02g023000 ID=Glyma.02g023000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MGAKFSTFEFVEKSSHSSSLILTFHSTAKWKAHFDVSKETNKLMVIDFTATWCGPCKYMDPIIKNFAAKYTDVEFIKIDVDELMEVAQAFQVQAMPTFILIKKGKVVEKVVGAKKEELQKLIDKHRN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||