SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.02G008700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.02G008700): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.02G008700

Feature Type:gene_model
Chromosome:Gm02
Start:879699
stop:880793
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G01850.1AT S-adenosylmethionine synthetase 2 JGI N/AIEA
GO:0006556GO-bp S-adenosylmethionine biosynthetic process EnsemblGenomesN/AIEA
GO:0006556GO-bp S-adenosylmethionine biosynthetic process JGI N/AIEA
GO:0004478GO-mf methionine adenosyltransferase activity EnsemblGenomesN/AIEA
GO:0004478GO-mf methionine adenosyltransferase activity JGI N/AIEA
GO:0005524GO-mf ATP binding EnsemblGenomesN/AIEA
PTHR11964Panther S-ADENOSYLMETHIONINE SYNTHETASE JGI N/AIEA
PF00438PFAM S-adenosylmethionine synthetase, N-terminal domain JGI N/AIEA
PF02772PFAM S-adenosylmethionine synthetase, central domain JGI N/AIEA
PF02773PFAM S-adenosylmethionine synthetase, C-terminal domain JGI N/AIEA
ETHYL-PWYSoyCyc9 ethylene biosynthesis I (plants) Plant Metabolic Network ISS
METHIONINE-DEG1-PWYSoyCyc9 L-methionine degradation I (to L-homocysteine) Plant Metabolic Network ISS
PWY-5041SoyCyc9 S-adenosyl-L-methionine cycle II Plant Metabolic Network ISS
PWY-5912SoyCyc9 2'-deoxymugineic acid phytosiderophore biosynthesis Plant Metabolic Network ISS
PWY-7270SoyCyc9 L-methionine salvage cycle II (plants) Plant Metabolic Network ISS
PWY-7528SoyCyc9 L-methionine salvage cycle I (bacteria and plants) Plant Metabolic Network ISS
SAM-PWYSoyCyc9 S-adenosyl-L-methionine biosynthesis Plant Metabolic Network ISS
GN7V-60432SoyCyc9-rxn methionine adenosyltransferase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.02G008700 not represented in the dataset

Glyma.02G008700 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.



>Glyma.02g008700.1 sequence-type=CDS polypeptide=Glyma.02g008700.1.p locus=Glyma.02g008700 ID=Glyma.02g008700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCGACAGAGACATTTCTATTCACCTCTGAATCTGTCAACGAGGGACTCCCTGACAAGCTGTGCGATCCTGACAGCAAGGTTGCCTGTGAGACATGCACCAAGACTAACATGATCATGGTCTTTGGAGAGATTACAACCGAGGCCAACGAGCATGTTATCAAGCCTGTGATTCCTGAGAAGTACTTGGATGACAAGACCATCTTCCACCTTAACCCTTCTGGTAGATTTGTCATTGGTGGCCCTCATGGTGATGCTGGTCTTACCGGAAGAAAGATTATCATTGATACTTATTGTGGCTGGGGTGCACATGGAGGTGGTGCTTTCTCAGGAAAGGACCCTACTAAGCAAGTGGACTTGCACGCAGGTGCATTGTTCAAGTTTCTTATGCCATTGGTGTTCCTGAGCCTTTGTCAGTTTGGAACTGGAAAGATTCCAGACAAGGAGATTCTTCAGCTTGTGAAGAAGAATTTTGACTTTAGGCCTGGGATGATCACCATTAACTTGGACCTTAAGAGGGGTGGCCATAGGTTCCTCAAGACAGCTGCCTATGGACACTTTGGAAGGGAGGATCCAGACTTCACCTGGGAAGTTGTTAAGCCACTCAAGTGGGACAAGCCTCAAGCTTAA

>Glyma.02g008700.1.p sequence-type=predicted peptide transcript=Glyma.02g008700.1 locus=Glyma.02g008700 ID=Glyma.02g008700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MATETFLFTSESVNEGLPDKLCDPDSKVACETCTKTNMIMVFGEITTEANEHVIKPVIPEKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYCGWGAHGGGAFSGKDPTKQVDLHAGALFKFLMPLVFLSLCQFGTGKIPDKEILQLVKKNFDFRPGMITINLDLKRGGHRFLKTAAYGHFGREDPDFTWEVVKPLKWDKPQA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo