Report for Sequence Feature Glyma.01g236900
| Feature Type: | gene_model |
| Chromosome: | Gm01 |
| Start: | 57309944 |
| stop: | 57310854 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Gene model name correspondences to Glyma.01g236900 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.01g236900
>Glyma.01g236900.1 sequence-type=CDS polypeptide=Glyma.01g236900.1.p locus=Glyma.01g236900 id=Glyma.01g236900.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGCTAATTTGTTTGAGGGGAAAGTTTAAAACGGAACATTATTCTGCCGAGGGATGCTGTGAGATCAAACAGTACTTTTCTCTCCACTTTGTTTATTTTCTTCATATTCTCTTGGTGCTCACTTTAATGGCATTTACTTTAAATCTCTTTGCTATCTATTGCAGCACAAATGCCCTTGGTTTTACCCCAAAATTTTTAGGACGTGTCAAGCTTTATACCTAG
Predicted protein sequences of Glyma.01g236900
>Glyma.01g236900.1.p sequence-type=predicted peptide transcript=Glyma.01g236900.1 locus=Glyma.01g236900 id=Glyma.01g236900.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MLICLRGKFKTEHYSAEGCCEIKQYFSLHFVYFLHILLVLTLMAFTLNLFAIYCSTNALGFTPKFLGRVKLYT*