Glyma.01g210800

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.01g210800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.01g210800): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.01g210800

Feature Type:	gene_model
Chromosome:	Gm01
Start:	54229414
stop:	54235179
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.01g210800

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G22570.1	AT	adenine phosphoribosyl transferase 3	JGI	N/A	IEA
GO:0006168	GO-bp	adenine salvage	EnsemblGenomes	N/A	IEA
GO:0009116	GO-bp	nucleoside metabolic process	EnsemblGenomes	N/A	IEA
GO:0009116	GO-bp	nucleoside metabolic process	JGI	N/A	IEA
GO:0005737	GO-cc	cytoplasm	EnsemblGenomes	N/A	IEA
GO:0005829	GO-cc	cytosol	EnsemblGenomes	N/A	IEA
GO:0003999	GO-mf	adenine phosphoribosyltransferase activity	EnsemblGenomes	N/A	IEA
KOG1712	KOG	Adenine phosphoribosyl transferases	JGI	N/A	IEA
PTHR11776	Panther	ADENINE PHOSPHORIBOSYLTRANSFERASE	JGI	N/A	IEA
PF00156	PFAM	Phosphoribosyl transferase domain	JGI	N/A	IEA
PWY-5043	SoyCyc9	purine nucleosides salvage II (plant)	Plant Metabolic Network		ISS
PWY-6605	SoyCyc9	adenine and adenosine salvage II	Plant Metabolic Network		ISS
GN7V-59403	SoyCyc9-rxn	adenine phosphoribosyltransferase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.01g210800

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.01g210800 not represented in the dataset	Glyma.01g210800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.01g210800

Paralog	Evidence	Comments
Glyma.11g031200	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.01g210800 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma01g41970	Wm82.a1.v1.1	IGC	As supplied by JGI

Transcripts of Glyma.01g210800

Limit To All Plant Sequences

>Glyma.01g210800.2 sequence-type=transcript locus=Glyma.01g210800 ID=Glyma.01g210800.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
AGACTCTTTCCATATACTACTACTACTCTCTCTCTCTATAAATATCGTGCAGACAGTGATAtcttcacctctcattgttgttcttctctttcttttattgcttcctttcccattcttcatcttcttctctctGAACCGTACTCAAACTCACTTTCCCACTTATTTATACAATGTCGGCTTACAAAGACCAGGATCCCCGTCTTCATGGCATCAAAACTAAGATTCGTGTCGTCCCCAATTTCCCCAAATCCGGTTCCTTTTTCTCCCTTTCCCTTTTAATCTTCTGTTTTCTTTAATGTTTTGTTTTTAGACTAAGAAACCAACCCGCGAGGCTTTGAATTCATGTTTTGTTTGACTTCCGTTTCCAATTTCCAGAAAGTCTTCTTCGGAGGtttctttttctttttttttcattttcactttagcttggtagctaatgttttttattttatttttTGCAACGGCAGGTCTTATGTTCCTAGACATTACTACTCTATTGCTTGATCCCAAAGCATTTAAGGACTCAATAGATTTGTTCGTGGAGCGGTACAAGGGCAAAAACATTTCTGTTGTTGCAGGAATTGAAGCTCGAGGTTTTATTTTTGGTCCCCCCATTGCGCTGGCTATAGGAGCAAAGTTTGTACCATTGAGGAAACCAAAGAAGTTGCCTGGAAAAGTTATTTCTCAAGAATATATTCTGGAATATGGAAGGGACTGTCTTGAGATGCATGTTGGAGCTGTTGATGATTTGATTGCAACTGGCGGAACACTCTGTGCCGCTATGGACTTGTTAGAACGTGTGGGAGCAGAAGTAGTGGAGTGTGCATGTGTAATTGAATTACCAGAATTGAAGGGTCGTGAACGTTTGAACGGGAAGCCCTTGTGCGTGTTGGTGGAATATGTGGATATATGATTATGAAGAAGTGGGCAAAAGAATATTAAGATGTAGATTTGGGAGATGATGTGTCTTTCAGTGGGTGCTTTCCCATTCTGATTACAATTCTAGCTTGTAGTAGGAACGATCAAATCAAATTAATGCATTTGTATGACCCACTCTTTGGGCTCATCTTCTCATCTCTTTTTCGAATAAAATTATATCTTTGGCT

Coding sequences of Glyma.01g210800

Limit To All Plant Sequences

>Glyma.01g210800.1 sequence-type=CDS polypeptide=Glyma.01g210800.1.p locus=Glyma.01g210800 ID=Glyma.01g210800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTCGGCTTACAAAGACCAGGATCCCCGTCTTCATGGCATCAAAACTAAGATTCGTGTCGTCCCCAATTTCCCCAAATCCGGTCTTATGTTCCTAGACATTACTACTCTATTGCTTGATCCCAAAGCATTTAAGGACTCAATAGATTTGTTCGTGGAGCGGTACAAGGGCAAAAACATTTCTGTTGTTGCAGGAATTGAAGCTCGAGGTTTTATTTTTGGTCCCCCCATTGCGCTGGCTATAGGAGCAAAGTTTGTACCATTGAGGAAACCAAAGAAGTTGCCTGGAAAAGTTATTTCTCAAGAATATATTCTGGAATATGGAAGGGACTGTCTTGAGATGCATGTTGGAGCTGTTGATGATTTGATTGCAACTGGCGGAACACTCTGTGCCGCTATGGACTTGTTAGAACGTGTGGGAGCAGAAGTAGTGGAGTGTGCATGTGTAATTGAATTACCAGAATTGAAGGGTCGTGAACGTTTGAACGGGAAGCCCTTGTGCGTGTTGGTGGAATATGTGGATATATGA

>Glyma.01g210800.2 sequence-type=CDS polypeptide=Glyma.01g210800.2.p locus=Glyma.01g210800 ID=Glyma.01g210800.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTTTTTTATTTTATTTTTTGCAACGGCAGGTCTTATGTTCCTAGACATTACTACTCTATTGCTTGATCCCAAAGCATTTAAGGACTCAATAGATTTGTTCGTGGAGCGGTACAAGGGCAAAAACATTTCTGTTGTTGCAGGAATTGAAGCTCGAGGTTTTATTTTTGGTCCCCCCATTGCGCTGGCTATAGGAGCAAAGTTTGTACCATTGAGGAAACCAAAGAAGTTGCCTGGAAAAGTTATTTCTCAAGAATATATTCTGGAATATGGAAGGGACTGTCTTGAGATGCATGTTGGAGCTGTTGATGATTTGATTGCAACTGGCGGAACACTCTGTGCCGCTATGGACTTGTTAGAACGTGTGGGAGCAGAAGTAGTGGAGTGTGCATGTGTAATTGAATTACCAGAATTGAAGGGTCGTGAACGTTTGAACGGGAAGCCCTTGTGCGTGTTGGTGGAATATGTGGATATATGA

Predicted protein sequences of Glyma.01g210800

Limit To All Plant Sequences

>Glyma.01g210800.1.p sequence-type=predicted peptide transcript=Glyma.01g210800.1 locus=Glyma.01g210800 ID=Glyma.01g210800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MSAYKDQDPRLHGIKTKIRVVPNFPKSGLMFLDITTLLLDPKAFKDSIDLFVERYKGKNISVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISQEYILEYGRDCLEMHVGAVDDLIATGGTLCAAMDLLERVGAEVVECACVIELPELKGRERLNGKPLCVLVEYVDI*

>Glyma.01g210800.2.p sequence-type=predicted peptide transcript=Glyma.01g210800.2 locus=Glyma.01g210800 ID=Glyma.01g210800.2.Wm82.a2.v1 annot-version=Wm82.a2.v1
MFFILFFATAGLMFLDITTLLLDPKAFKDSIDLFVERYKGKNISVVAGIEARGFIFGPPIALAIGAKFVPLRKPKKLPGKVISQEYILEYGRDCLEMHVGAVDDLIATGGTLCAAMDLLERVGAEVVECACVIELPELKGRERLNGKPLCVLVEYVDI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain