Report for Sequence Feature Glyma.01g190500
| Feature Type: | gene_model |
| Chromosome: | Gm01 |
| Start: | 53633851 |
| stop: | 53634751 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.01g190500
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT2G15000.1 | AT |
|
JGI | N/A | IEA |
| PTHR33156 | PantherFam |
OS02G0230000 PROTEIN |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.01g190500 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma01g39770 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.01g190500
>Glyma.01g190500.1 sequence-type=CDS polypeptide=Glyma.01g190500.1.p locus=Glyma.01g190500 id=Glyma.01g190500.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGCGTGGCGCTGCGGATCTCTCTCTCGGTCGGTGCTCTCGGCCGCGAGAACCATTCCAACTCGTTCCTCCATTTCTCCACTCTCGCCTTCCCTTCGCTCTCATCTTCTCCACTCTCGCCGCCCCCTCAATACACTCCCTAGGACTGTGGGAATTCTCGTGTGCACGCATTCGCTGATGCCTCTGCACAGCGCTGACGCCTCCGCTCGTCTCACTTCTCACATTTCCGTCGAATCGCGCGCTTGCTGCGAATTGTCTCAGGGTACTTGA
Predicted protein sequences of Glyma.01g190500
>Glyma.01g190500.1.p sequence-type=predicted peptide transcript=Glyma.01g190500.1 locus=Glyma.01g190500 id=Glyma.01g190500.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MAWRCGSLSRSVLSAARTIPTRSSISPLSPSLRSHLLHSRRPLNTLPRTVGILVCTHSLMPLHSADASARLTSHISVESRACCELSQGT*