Report for Sequence Feature Glyma.01g162400
| Feature Type: | gene_model |
| Chromosome: | Gm01 |
| Start: | 51150370 |
| stop: | 51151444 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.01g162400
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT4G35000.1 | AT |
APX3 |
JGI | N/A | IEA |
| 1.11.1.11 | EC |
L-ascorbate peroxidase |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.01g162400 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.01g162400
>Glyma.01g162400.1 sequence-type=CDS polypeptide=Glyma.01g162400.1.p locus=Glyma.01g162400 id=Glyma.01g162400.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGAAGAACCTGTTGTTGACGAGGAGTATCTCAAGGAAATGACGATGGCTCGACGTGAACTTGGCGCTTTCATCACCAACAATAAACGCGCCCCTCTCATGCTTCAGTTATCGGATTCAAATGAGCCTCCGCGAACTGAATAG
Predicted protein sequences of Glyma.01g162400
>Glyma.01g162400.1.p sequence-type=predicted peptide transcript=Glyma.01g162400.1 locus=Glyma.01g162400 id=Glyma.01g162400.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MEEPVVDEEYLKEMTMARRELGAFITNNKRAPLMLQLSDSNEPPRTE*