|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G60540.1 | AT | pyridoxine biosynthesis 2 | JGI | N/A | IEA |
| GO:0008614 | GO-bp | pyridoxine metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0042819 | GO-bp | vitamin B6 biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0042823 | GO-bp | pyridoxal phosphate biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0005829 | GO-cc | cytosol | EnsemblGenomes | N/A | IEA |
| GO:1903600 | GO-cc | glutaminase complex | EnsemblGenomes | N/A | IEA |
| GO:0004359 | GO-mf | glutaminase activity | EnsemblGenomes | N/A | IEA |
| PF01174 | PFAM | SNO glutamine amidotransferase family | JGI | N/A | IEA |
| GLUTAMINDEG-PWY | SoyCyc9 | L-glutamine degradation I | Plant Metabolic Network | ISS | |
| PWY-6466 | SoyCyc9 | pyridoxal 5'-phosphate biosynthesis II | Plant Metabolic Network | ISS | |
| GN7V-42050 | SoyCyc9-rxn | pyridoxal 5'-phosphate synthase (glutamine hydrolyzing) | Plant Metabolic Network | ISS |
|
Glyma.01g112800 not represented in the dataset |
Glyma.01g112800 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma01g27765 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.01g112800.1 sequence-type=CDS polypeptide=Glyma.01g112800.1.p locus=Glyma.01g112800 ID=Glyma.01g112800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGACTAACATCATTTCAGGGCAGAAGACTGGTGGACAATATTTGGTTGGTGGACTTGATTGTACAGTGCATATAAATTTCTTTGGTAGCCAGATTCAAAGCTTTGAGGCAGAGCTTTTAGTGCCAGAGCTTGTCTCCAAGGAAGGAGGTCCTGAATCATTTTGTGGAATTTTTATTCATGCCCCTGCAATTCTTGAAGCAGGGCCAAAAGTTCAAGTGCTGGCTGATTATCCTGTACCTTCTAGCAAATTGTTGAGTTTTGATTCCTCTATTGAAGACCAAACAGTTAATTAA
>Glyma.01g112800.1.p sequence-type=predicted peptide transcript=Glyma.01g112800.1 locus=Glyma.01g112800 ID=Glyma.01g112800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MTNIISGQKTGGQYLVGGLDCTVHINFFGSQIQSFEAELLVPELVSKEGGPESFCGIFIHAPAILEAGPKVQVLADYPVPSSKLLSFDSSIEDQTVN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||