SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma.01g112000

Feature Type:gene_model
Chromosome:Gm01
Start:37976590
stop:37977183
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G71697.1AT choline kinase 1 JGI N/AIEA
PTHR22603Panther CHOLINE/ETHANOALAMINE KINASE JGI N/AIEA
PTHR22603:SF8Panther JGI N/AIEA
PHOSLIPSYN2-PWYSoyCyc9 superpathway of phospholipid biosynthesis II (plants) Plant Metabolic Network ISS
PWY-3385SoyCyc9 choline biosynthesis I Plant Metabolic Network ISS
PWY-4762SoyCyc9 superpathway of choline biosynthesis Plant Metabolic Network ISS
PWY3O-450SoyCyc9 phosphatidylcholine biosynthesis I Plant Metabolic Network ISS
PWY4FS-5SoyCyc9 superpathway of phosphatidylcholine biosynthesis Plant Metabolic Network ISS
PWY4FS-6SoyCyc9 phosphatidylethanolamine biosynthesis II Plant Metabolic Network ISS
GN7V-65354SoyCyc9-rxn choline kinase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.01g112000 not represented in the dataset

Glyma.01g112000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma01g27385 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.01g112000.1 sequence-type=CDS polypeptide=Glyma.01g112000.1.p locus=Glyma.01g112000 ID=Glyma.01g112000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAGGATAATCTCCCTTCAACTGTTTTAGATGGGACTGTTGTTGGGATCAAATTTGTGGCAACTGGCAACTCCTTGCACACAGGCAACAAACCAAGCAATGCTAAAGTGAACCAGTTAGTGAAAGCTGCAGAAAAATACACTCTTGCAAACCATCTATTTTGGGGTTTGTGGGGACTTATTTCGAGTTATGTGAACAAAATTGACTTTGACTATAAGGAGTATGGAAGGCAGAGGTTTCAACAATACTGGATAAGGAAGCCTAGTTTATTGGACTCGCCAAGCATCATTTCCCTAGATGAAACTGTGAATGGATTGTTGCCATCCTTCACGTGA

>Glyma.01g112000.1.p sequence-type=predicted peptide transcript=Glyma.01g112000.1 locus=Glyma.01g112000 ID=Glyma.01g112000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MEDNLPSTVLDGTVVGIKFVATGNSLHTGNKPSNAKVNQLVKAAEKYTLANHLFWGLWGLISSYVNKIDFDYKEYGRQRFQQYWIRKPSLLDSPSIISLDETVNGLLPSFT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo