|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G11545.1 | AT | xyloglucan endotransglucosylase/hydrolase 8 | JGI | N/A | IEA |
GO:0005975 | GO-bp | carbohydrate metabolic process | EnsemblGenomes | N/A | IEA |
GO:0005975 | GO-bp | carbohydrate metabolic process | JGI | N/A | IEA |
GO:0004553 | GO-mf | hydrolase activity, hydrolyzing O-glycosyl compounds | EnsemblGenomes | N/A | IEA |
GO:0004553 | GO-mf | hydrolase activity, hydrolyzing O-glycosyl compounds | JGI | N/A | IEA |
PF00722 | PFAM | Glycosyl hydrolases family 16 | JGI | N/A | IEA |
GN7V-65232 | SoyCyc9-rxn | xyloglucan:xyloglucosyl transferase | Plant Metabolic Network | ISS |
Glyma.01g081400 not represented in the dataset |
Glyma.01g081400 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma01g20565 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.01g081400.1 sequence-type=CDS polypeptide=Glyma.01g081400.1.p locus=Glyma.01g081400 ID=Glyma.01g081400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGAACAATATCAATGATTATGCAGAATCCCTCTTTCAGTTGTGCTCAGAAAATGGTGCGGGGCCAGAAAGAGATGAACTTGATTTTGAGTTTTTGGGAAACAAAACAGGAGAGCCTTATTTGATTCAGACTAATGTATACAAGAATGGGACTGGTGGGCGTAAGATGAGGCACATGCTTTGGTTTGACCCCACAGAGGACTACCACACCTATTCCATTCACGAGGGAAGAATTAGAATGATATCATGTTAA
>Glyma.01g081400.1.p sequence-type=predicted peptide transcript=Glyma.01g081400.1 locus=Glyma.01g081400 ID=Glyma.01g081400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MNNINDYAESLFQLCSENGAGPERDELDFEFLGNKTGEPYLIQTNVYKNGTGGRKMRHMLWFDPTEDYHTYSIHEGRIRMISC*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||