SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.01g073300

Feature Type:gene_model
Chromosome:Gm01
Start:14036201
stop:14036532
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.01g073300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20570.2AT RING-box 1 JGI N/AIEA
GO:0016567GO-bp protein ubiquitination EnsemblGenomesN/AIEA
GO:0031146GO-bp SCF-dependent proteasomal ubiquitin-dependent protein catabolic process EnsemblGenomesN/AIEA
GO:0045116GO-bp protein neddylation EnsemblGenomesN/AIEA
GO:0031462GO-cc Cul2-RING ubiquitin ligase complex EnsemblGenomesN/AIEA
GO:0031463GO-cc Cul3-RING ubiquitin ligase complex EnsemblGenomesN/AIEA
GO:0031467GO-cc Cul7-RING ubiquitin ligase complex EnsemblGenomesN/AIEA
GO:0043224GO-cc nuclear SCF ubiquitin ligase complex EnsemblGenomesN/AIEA
GO:0080008GO-cc Cul4-RING E3 ubiquitin ligase complex EnsemblGenomesN/AIEA
GO:0008270GO-mf zinc ion binding JGI N/AIEA
GO:0019788GO-mf NEDD8 transferase activity EnsemblGenomesN/AIEA
GO:0061630GO-mf ubiquitin protein ligase activity EnsemblGenomesN/AIEA
GO:0097602GO-mf cullin family protein binding EnsemblGenomesN/AIEA
PTHR11210Panther RING BOX JGI N/AIEA

Expression Patterns of Glyma.01g073300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.01g073300 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma01g13960 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.01g073300
>Glyma.01g073300.1 sequence-type=CDS polypeptide=Glyma.01g073300.1.p locus=Glyma.01g073300 ID=Glyma.01g073300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCGACTCTAGATTTCGACGTTCCTATGGTTCCTACCGGCGAGCCCTCAAGTAACGTCGGTCCTTCTTCCAAGAAGCCCAAGCACTTCGAGATCAAGAAGTGGAACGTCGTCACTCTCTGGGCTTGGGACATCGTTGTCGATAACTGTGCTATATGTTGGAACCACATCATGGATCTCTGTAAGAAATTTCACTTTTTCCAATTGAAAACAGTTCTTTTATTTGAAGCATTTCGTTCCGCTTCTTGA
Predicted protein sequences of Glyma.01g073300
>Glyma.01g073300.1.p sequence-type=predicted peptide transcript=Glyma.01g073300.1 locus=Glyma.01g073300 ID=Glyma.01g073300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MATLDFDVPMVPTGEPSSNVGPSSKKPKHFEIKKWNVVTLWAWDIVVDNCAICWNHIMDLCKKFHFFQLKTVLLFEAFRSAS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo