Report for Sequence Feature Glyma.01g071400
| Feature Type: | gene_model |
| Chromosome: | Gm01 |
| Start: | 12886160 |
| stop: | 12886412 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.01g071400
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT3G02468.1 | AT |
CPuORF9 |
JGI | N/A | IEA |
| PTHR35727 | PantherFam |
BNAA05G33520D PROTEIN |
JGI | N/A | IEA |
| PF08132 | Pfam |
S-adenosyl-l-methionine decarboxylase leader peptide |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.01g071400 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma01g10070 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.01g071400
>Glyma.01g071400.1 sequence-type=CDS polypeptide=Glyma.01g071400.1.p locus=Glyma.01g071400 id=Glyma.01g071400.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGAGTCTAAAGGTGGGAAAAAGAAGTCTAGTAGTAGTAGTAGTAAATCATTGTTCTACGAAGCTCCCCTCGGATACAGCATTGAAGACGTTAGACCAAACGGTGGAATCAAGAAATTCAGATCTGCTGCTTACTCCAACTGCGCTCGCAAACCTTCCTGA
Predicted protein sequences of Glyma.01g071400
>Glyma.01g071400.1.p sequence-type=predicted peptide transcript=Glyma.01g071400.1 locus=Glyma.01g071400 id=Glyma.01g071400.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MESKGGKKKSSSSSSKSLFYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS*