SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.01g062800

Feature Type:gene_model
Chromosome:Gm01
Start:8838772
stop:8840343
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.01g062800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G38970.1AT brassinosteroid-6-oxidase 1 JGI N/AIEA
GO:0055114GO-bp oxidation-reduction process EnsemblGenomesN/AIEA
GO:0055114GO-bp oxidation-reduction process JGI N/AIEA
GO:0004497GO-mf monooxygenase activity EnsemblGenomesN/AIEA
GO:0005506GO-mf iron ion binding EnsemblGenomesN/AIEA
GO:0005506GO-mf iron ion binding JGI N/AIEA
GO:0009055GO-mf electron carrier activity JGI N/AIEA
GO:0016705GO-mf oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen EnsemblGenomesN/AIEA
GO:0016705GO-mf oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen JGI N/AIEA
GO:0020037GO-mf heme binding EnsemblGenomesN/AIEA
GO:0020037GO-mf heme binding JGI N/AIEA
GO:0046872GO-mf metal ion binding EnsemblGenomesN/AIEA
PTHR24286Panther FAMILY NOT NAMED JGI N/AIEA
PTHR24286:SF21Panther JGI N/AIEA
PF00067PFAM Cytochrome P450 JGI N/AIEA
PWY-6544SoyCyc9 superpathway of C28 brassinosteroid biosynthesis Plant Metabolic Network ISS
PWY-699SoyCyc9 brassinosteroid biosynthesis I Plant Metabolic Network ISS
GN7V-61071SoyCyc9-rxn Enzyme name not determined Plant Metabolic Network ISS

Expression Patterns of Glyma.01g062800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.01g062800 not represented in the dataset
Glyma.01g062800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.01g062800
ParalogEvidenceComments
Glyma.02g120700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.01g062800 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma01g07893 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.01g062800
>Glyma.01g062800.1 sequence-type=CDS polypeptide=Glyma.01g062800.1.p locus=Glyma.01g062800 ID=Glyma.01g062800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTATCAACTACTATAATGATGGTTATCAAATACCTATGTGATAACCCAAGTGATGAGCATTTTGCAATCCAACAAAAGAAAATGTCTGAGGAACGGATCGGCTGGGATGACTACAAGAATATGAGCCTAACTCGTGCGGTGATACTTGAAACCATGAGATTGGTTAGTGTTGTTGCTAGAGTGATGAGGAGGGCCACTAATGATATAGAATCAAATGGTTTTATGATTCCCAAGGGATGGAGAGTTTACTTTTACACAAAGGAGACTAACTTTGACCCGTTCCTCTATGAAGAACCTTTTACTTTTAATCCATGGAGATGGCTGGAGAAGAAAGGCTTGAAGTCTCATAATCACAACATGTTGTTTGGAGCAGGAGGCAGGGTCCTTTTCCTTCACTACTTTGTGACTAGATACAGGGAAAAACTTATGAAATTCCCGAAAGTGTTGGCACCAGAAGGACTACACATAATAGAATACTAG
Predicted protein sequences of Glyma.01g062800
>Glyma.01g062800.1.p sequence-type=predicted peptide transcript=Glyma.01g062800.1 locus=Glyma.01g062800 ID=Glyma.01g062800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVSTTIMMVIKYLCDNPSDEHFAIQQKKMSEERIGWDDYKNMSLTRAVILETMRLVSVVARVMRRATNDIESNGFMIPKGWRVYFYTKETNFDPFLYEEPFTFNPWRWLEKKGLKSHNHNMLFGAGGRVLFLHYFVTRYREKLMKFPKVLAPEGLHIIEY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo