|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G26660.1 | AT | Prefoldin chaperone subunit family protein | JGI | N/A | IEA |
GO:0006357 | GO-bp | regulation of transcription by RNA polymerase II | EnsemblGenomes | N/A | IEA |
GO:0006457 | GO-bp | protein folding | EnsemblGenomes | N/A | IEA |
GO:0006457 | GO-bp | protein folding | JGI | N/A | IEA |
GO:0005634 | GO-cc | nucleus | EnsemblGenomes | N/A | IEA |
GO:0016272 | GO-cc | prefoldin complex | EnsemblGenomes | N/A | IEA |
GO:0016272 | GO-cc | prefoldin complex | JGI | N/A | IEA |
GO:0051082 | GO-mf | unfolded protein binding | EnsemblGenomes | N/A | IEA |
GO:0051082 | GO-mf | unfolded protein binding | JGI | N/A | IEA |
KOG3047 | KOG | Predicted transcriptional regulator UXT | JGI | N/A | IEA |
PTHR13345 | Panther | NUT2 AND UXT | JGI | N/A | IEA |
PTHR13345:SF3 | Panther | PROTEIN UXT | JGI | N/A | IEA |
PF02996 | PFAM | Prefoldin subunit | JGI | N/A | IEA |
Glyma.01g053200 not represented in the dataset |
Glyma.01g053200 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Paralog | Evidence | Comments |
---|---|---|
Glyma.02g111700 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma01g06380 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.01g053200.1 sequence-type=CDS polypeptide=Glyma.01g053200.1.p locus=Glyma.01g053200 ID=Glyma.01g053200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGACAGCTTACGCCAGGAGAAAGTTCAAAGATTTGAAGAATTTGTTGACAAACGCCTGAAACCTGATCTTGTTCATGCTATTGCTCAGCGGGACAAGGTATTTGAACAACAGAAAATTTTCACTGATTTGAGAAAAAACATTGAAAACCTTGAGAAGAATAGTGTAACCAGTCTAAGAACTTTGGTCAATATTGGGTCTGAAGTATACCTGCAGGCAGAAGTGCCAGATACACAACACATATTTGTGGATGTAGGATTTGGATTCCATGTGGAGTTTACTTGGTCAGAAGCTCTGAACTACATAGATAAAAGGGAAGAAAAGATAGCCAGGCAGATAGAGGAGTACACCCAGTTGATTGCATCAATTAAAGCTCAGATTAAGCTTGTTTGTGAAGGGATTCGAGAATTACTGCAACTTCCAGCTGAGAAATCCTTACCAGAACGGATATTTTGA
>Glyma.01g053200.1.p sequence-type=predicted peptide transcript=Glyma.01g053200.1 locus=Glyma.01g053200 ID=Glyma.01g053200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MDSLRQEKVQRFEEFVDKRLKPDLVHAIAQRDKVFEQQKIFTDLRKNIENLEKNSVTSLRTLVNIGSEVYLQAEVPDTQHIFVDVGFGFHVEFTWSEALNYIDKREEKIARQIEEYTQLIASIKAQIKLVCEGIRELLQLPAEKSLPERIF*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||