SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.01g039300

Feature Type:gene_model
Chromosome:Gm01
Start:4256747
stop:4258161
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.01g039300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G29080.1AT phytochrome-associated protein 2 JGI N/AIEA
GO:0006351GO-bp transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated JGI N/AIEA
GO:0009734GO-bp auxin-activated signaling pathway EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus EnsemblGenomesN/AIEA
GO:0005634GO-cc nucleus JGI N/AIEA
GO:0005515GO-mf protein binding EnsemblGenomesN/AIEA
PF02309PFAM AUX/IAA family JGI N/AIEA

Proteins Associated with Glyma.01g039300
LocusGene SymbolProtein Name
IAA2 Indole-3-Acetic Acid Responsive Gene 2

Expression Patterns of Glyma.01g039300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.01g039300 not represented in the dataset
Glyma.01g039300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.01g039300 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma01g04616 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.01g039300
>Glyma.01g039300.1 sequence-type=CDS polypeptide=Glyma.01g039300.1.p locus=Glyma.01g039300 ID=Glyma.01g039300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
TGCACCAACCAACCAACTGCTTTGGGTGCTTCTGTTCTCAGGGAAACTATTCCACACTCTCCAAAACCATTACATGAGAATAAGCCCCAGATTTCTGTTGCAACTGCAAAGGCGCAAGTTGTGGGATGGCCACCAATCCGTTCATTCAGGAAGAACTCAATGGCTTCTCAGCCTCAGAAGAATGATGTTGCTGCTAATGCAGAAGCCAAGTCTGGATGCCTTTATGTTAAAGTCAACATGGAAGGCTCCCCATACTTAAGGAAAGTGGATCTGAATAGTTTTACCACTTACAAGGACCTCTCTTTGGCACTTGAAAAGATGTTTAGTTGTTTTACACTCAGTCAATGTGGCTCATATGGGGTTTCTAGTCGGGAAAATTTAAGTGAAAGTAGATTGATGGATCTCCTTCATGGTTCAAAATATGTTCTTATCTATGAAGACAAGGATGGAGATTGGATGCTAGTTGGTGATGTTCTGTGGGAGTAA
Predicted protein sequences of Glyma.01g039300
>Glyma.01g039300.1.p sequence-type=predicted peptide transcript=Glyma.01g039300.1 locus=Glyma.01g039300 ID=Glyma.01g039300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
CTNQPTALGASVLRETIPHSPKPLHENKPQISVATAKAQVVGWPPIRSFRKNSMASQPQKNDVAANAEAKSGCLYVKVNMEGSPYLRKVDLNSFTTYKDLSLALEKMFSCFTLSQCGSYGVSSRENLSESRLMDLLHGSKYVLIYEDKDGDWMLVGDVLWE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo