|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G51060.1 | AT | histone H2A 10 | JGI | N/A | IEA |
| GO:0006342 | GO-bp | chromatin silencing | EnsemblGenomes | N/A | IEA |
| GO:0000786 | GO-cc | nucleosome | EnsemblGenomes | N/A | IEA |
| GO:0000790 | GO-cc | nuclear chromatin | EnsemblGenomes | N/A | IEA |
| GO:0005622 | GO-cc | intracellular | JGI | N/A | IEA |
| GO:0005634 | GO-cc | nucleus | EnsemblGenomes | N/A | IEA |
| GO:0005694 | GO-cc | chromosome | EnsemblGenomes | N/A | IEA |
| GO:0003677 | GO-mf | DNA binding | EnsemblGenomes | N/A | IEA |
| GO:0003677 | GO-mf | DNA binding | JGI | N/A | IEA |
| GO:0043565 | GO-mf | sequence-specific DNA binding | JGI | N/A | IEA |
| GO:0046982 | GO-mf | protein heterodimerization activity | EnsemblGenomes | N/A | IEA |
| KOG1756 | KOG | Histone 2A | JGI | N/A | IEA |
| PTHR23430 | Panther | HISTONE H2A | JGI | N/A | IEA |
| PF00125 | PFAM | Core histone H2A/H2B/H3/H4 | JGI | N/A | IEA |
|
Glyma.01g022100 not represented in the dataset |
Glyma.01g022100 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma01g02720 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.01g022100.1 sequence-type=CDS polypeptide=Glyma.01g022100.1.p locus=Glyma.01g022100 ID=Glyma.01g022100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCGGGTAGAGGCAAAACCCTAGGATCCAGCGCCGCTAAGAAGGCCACCTCAAGGAGCAGCAAAGCCGGCCTCCAATTCCCCGTCGGTCGTATCGCCAGGTTCCTCAAGGCCGGAAAGTACGCCGAGCGCGTCGGCGCCGGAGCCCCCGTCTACCTCGCCGCCGTTCTCGAATATCTCGCTGCTGAGGTTTTGGAATTGGCTGGAAACGCTGCGAGAGATAACAAGAAGACTCGAATTGTTCCACGCCACATCCAATTGGCGGTGAGGAACGACGAAGAGTTGAGCAAGCTTCTAGGAGATGTTACCATTGCTAACGGCGGTGTTATGCCTAACATTCACAACCTTCTTCTTCCCAAGAAGGCTGGGGGCTCATCCAAGGGTGCTGCTGCTGACGATGACTCTTAA
>Glyma.01g022100.1.p sequence-type=predicted peptide transcript=Glyma.01g022100.1 locus=Glyma.01g022100 ID=Glyma.01g022100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MAGRGKTLGSSAAKKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGDVTIANGGVMPNIHNLLLPKKAGGSSKGAAADDDS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||