Glyma.01g009600

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.01g009600

Feature Type:	gene_model
Chromosome:	Gm01
Start:	937652
stop:	940822
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.01g009600

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G45580.1	AT	Homeodomain-like superfamily protein	JGI	N/A	IEA
GO:0006351	GO-bp	transcription, DNA-templated	EnsemblGenomes	N/A	IEA
GO:0006355	GO-bp	regulation of transcription, DNA-templated	EnsemblGenomes	N/A	IEA
GO:0005634	GO-cc	nucleus	EnsemblGenomes	N/A	IEA
GO:0003677	GO-mf	DNA binding	EnsemblGenomes	N/A	IEA
GO:0003682	GO-mf	chromatin binding	JGI	N/A	IEA
PF00249	PFAM	Myb-like DNA-binding domain	JGI	N/A	IEA

Proteins Associated with Glyma.01g009600

Locus	Gene Symbol	Protein Name
	PHR1	MYB-CC domain-containing transcription factor PHR1

Expression Patterns of Glyma.01g009600

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.01g009600

Paralog	Evidence	Comments
Glyma.09g211400	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.01g009600 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma01g01300	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.01g009600

Limit To All Plant Sequences

>Glyma.01g009600.1 sequence-type=CDS polypeptide=Glyma.01g009600.1.p locus=Glyma.01g009600 ID=Glyma.01g009600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGAGGGTGGTGGAAGAGAAGGTTATAATGGAGTCATCATGACGATGACACGAGACCCGAAGCCGAGGCTACGGTGGACGGCAGATCTCCATGACCGGTTTGTGGATGCAGTCACAAAGCTTGGTGGCCCCGATAAGGCGACTCCCAAGTCTGTTCTGAGGTTAATGGGCTTGAAAGGGCTGACACTATATCATTTGAAGAGCCATTTACAGAAGTATAGACTTGGACAGCAGGCTCAAAAACAAAATGAGGAAGTGCACAAAGAGAATAGTAGATGTTCGTATGTAAATTTTAGTAATCGTTCTTTGGCACCAAACACCAGTTACAGAGGTGATGATGAAGGGGGAGAAATCCCAATAGCAGAAGCATTGAGGTGTCAGATTGAAGTTCAAAAGCGATTGGAAGAGCAGCTAAAGGTACAGAAGAAATTGCAGATGAGAATAGAGGCACAAGGGAAGTATTTGCAATCGGTGTTAGAGAAAGCCCAGAGGAGCCTTTCCCTGGATGGACCAGGCAGTCTTGAAGCATCAAGAGCTGAGTTGACTGAATTCAACTCTGCTTTGTCAAATTTCATGGAAAATATGAATAAAGATAGCAAACAAAACATAATAGAAGTGAATAATTTTTATAGTAAGAGCCATGGCTCAGCTTTCTATAATCAGGAAGTAGGAAGAGAACAAAATAGGGACCAAAAGCCAAAGGTTGAAGGGGGTTCTATACAGTTTGACTTAAACATCAAAGGTAGCAATGACCTTGTATCTGCAGGTGGGGCTGAAATGGATGCCAATATGGTTTCATCATATAGGGTATAA

Predicted protein sequences of Glyma.01g009600

Limit To All Plant Sequences

>Glyma.01g009600.1.p sequence-type=predicted peptide transcript=Glyma.01g009600.1 locus=Glyma.01g009600 ID=Glyma.01g009600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MEGGGREGYNGVIMTMTRDPKPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRLGQQAQKQNEEVHKENSRCSYVNFSNRSLAPNTSYRGDDEGGEIPIAEALRCQIEVQKRLEEQLKVQKKLQMRIEAQGKYLQSVLEKAQRSLSLDGPGSLEASRAELTEFNSALSNFMENMNKDSKQNIIEVNNFYSKSHGSAFYNQEVGREQNRDQKPKVEGGSIQFDLNIKGSNDLVSAGGAEMDANMVSSYRV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain