Glyma.01G215200

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.01G215200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.01G215200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.01G215200

Feature Type:	gene_model
Chromosome:	Gm01
Start:	54590512
stop:	54591022
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.01G215200

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G00240.1	AT	phospholipase D beta 2	JGI	N/A	IEA
GO:0005886	GO-cc	plasma membrane	EnsemblGenomes	N/A	IEA
GO:0016021	GO-cc	integral component of membrane	EnsemblGenomes	N/A	IEA
GO:0005524	GO-mf	ATP binding	EnsemblGenomes	N/A	IEA
GO:0016887	GO-mf	ATPase activity	EnsemblGenomes	N/A	IEA
GO:0042626	GO-mf	ATPase activity, coupled to transmembrane movement of substances	EnsemblGenomes	N/A	IEA
PTHR18896	Panther	PHOSPHOLIPASE D	JGI	N/A	IEA
PTHR18896:SF15	Panther	PHOSPHOLIPASE D BETA 1-RELATED	JGI	N/A	IEA
LIPASYN-PWY	SoyCyc9	phospholipases	Plant Metabolic Network		ISS
PWY-3561	SoyCyc9	choline biosynthesis III	Plant Metabolic Network		ISS
PWY-4762	SoyCyc9	superpathway of choline biosynthesis	Plant Metabolic Network		ISS
PWY-7039	SoyCyc9	phosphatidate metabolism, as a signaling molecule	Plant Metabolic Network		ISS
GN7V-41751	SoyCyc9-rxn	phospholipase D	Plant Metabolic Network		ISS

Expression Patterns of Glyma.01G215200

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.01G215200 not represented in the dataset	Glyma.01G215200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Coding sequences of Glyma.01G215200

Limit To All Plant Sequences

>Glyma.01g215200.1 sequence-type=CDS polypeptide=Glyma.01g215200.1.p locus=Glyma.01g215200 ID=Glyma.01g215200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAAAGAGAAGGGGTCTGTCACTTATTGTCCAAGACAACCATGGCACGATTTGCATTCCCAAGTTGATGGTCCAGCAGCATATGACATCCTCACCAATTTTGAGGAGCGTTGGTTAAGGGCATTAAAAATGCATAGATTTCAAAAGATGAAAAGTTCACATGATGATTCATTACTGAAAATTGATAGAATCCCTGACATTTGTTGGCATTGA

Predicted protein sequences of Glyma.01G215200

Limit To All Plant Sequences

>Glyma.01g215200.1.p sequence-type=predicted peptide transcript=Glyma.01g215200.1 locus=Glyma.01g215200 ID=Glyma.01g215200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MKEKGSVTYCPRQPWHDLHSQVDGPAAYDILTNFEERWLRALKMHRFQKMKSSHDDSLLKIDRIPDICWH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain