SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.01G080400

Feature Type:gene_model
Chromosome:Gm01
Start:22123621
stop:22126726
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.01G080400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G68260.1AT Thioesterase superfamily protein JGI N/AIEA
PF03061PFAM Thioesterase superfamily JGI N/AIEA
PWY-5142SoyCyc9 acyl-ACP thioesterase pathway Plant Metabolic Network ISS
PWY-5366SoyCyc9 palmitoleate biosynthesis II (plants and bacteria) Plant Metabolic Network ISS
GN7V-64594SoyCyc9-rxn oleoyl-[acyl-carrier-protein] hydrolase Plant Metabolic Network ISS

Proteins Associated with Glyma.01G080400
LocusGene SymbolProtein Name
MKS2 methylketone synthase 2
MKS2 methylketone synthase 2

Expression Patterns of Glyma.01G080400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.01G080400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g080400 Wm82.a4.v1ISS As supplied by JGI
Glyma01g19200 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.01G080400
>Glyma.01g080400.1 sequence-type=CDS polypeptide=Glyma.01g080400.1.p locus=Glyma.01g080400 ID=Glyma.01g080400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCTCTACAACCACACTTCCTCGATGTCATTGCCTTCCCCATTGTACCTGAATACTACGTCGTTTCGCCTCACGCGCCAATCTCCTTTTCCTTTTCCCCGCCGGCGCTTCAATCCACCGGCTTTCCGATCAGTTTCGCCGTTGAGTTCCAGCCCCTCTGCATCACTCTTCGATCTCAGAGGGGGCAAAGGAATGAGTGGATTCCATGACGTTGAACTGAAGGTGCGCGACTATGAGTTGGATCAGTACGGTGTGGTTAACAATGCAGTTTATGCTAGTTATTGCCAGCACGGTCGTCATGAACTCTTGCAAAACATTGGTATTAATTGCGATGCTGTGGCTCGCAGTGGTGATGCATTGGCATTGTCTGAACTATCGCTCAAATTCCTTGCACCTCTAAGAAGTGGAGACAAATTTGTTGTAAGAGTTAGGATTTCTGGCTCTTCAGCTGCTCGTTTATACTTTGATCACTTCATCTATAAGCTGCCAAACCAAGAGCCTATTTTGGAAGCCAAGGCCATAGCGGTGTGGCTTGACAAAAACTATCGTCCTATACGAATTCCAGCAGAGATGAAGTCTAAATTTGTAAAGTTTATTCGAATTGAGGACTCTTAA
Predicted protein sequences of Glyma.01G080400
>Glyma.01g080400.1.p sequence-type=predicted peptide transcript=Glyma.01g080400.1 locus=Glyma.01g080400 ID=Glyma.01g080400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MLYNHTSSMSLPSPLYLNTTSFRLTRQSPFPFPRRRFNPPAFRSVSPLSSSPSASLFDLRGGKGMSGFHDVELKVRDYELDQYGVVNNAVYASYCQHGRHELLQNIGINCDAVARSGDALALSELSLKFLAPLRSGDKFVVRVRISGSSAARLYFDHFIYKLPNQEPILEAKAIAVWLDKNYRPIRIPAEMKSKFVKFIRIEDS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo